SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000001483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000001483
Domain Number 1 Region: 260-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-45
Family SPRY domain 0.0022
Further Details:      
 
Domain Number 2 Region: 157-265
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000692
Family Fibronectin type III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000001483
Sequence length 468
Comment (Anolis carolinensis)
Sequence
LQQTLEMNLTNLMKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELMEIIRQRKQ
VIAVKIKETKVMKLRKLAQQVANCRQCLERSTALINQAEHILKENDHARFLQTAKNVAER
VAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSVREELCTASHDT
ITVHWISDDEFCVSSYELQYTIFTGQANFISLYNSMDSWMIVPNIKQNHYTVHGLQSGTR
YIFLVKAINQAGSRNSDPARLKTNSQPFKLDPKVAHKKLKISNDGLQMEKDESSLKKSHT
PERFSGTGCYGAAGNVFIDSGCHYWEVTLGSSTWYAIGIAYKSAPKNEWIGKNSSSWVFS
RCNNNFVVRHNNKEMLVDVHPQMKRLGVLLDYDNNVLSFYDPANSLHLHTFEISFILPVC
PTFTIWNKSLMIVSGLPAPDFIDYPETQECNCRPPQESPYVSGMKTCH
Download sequence
Identical sequences 28377.ENSACAP00000001483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]