SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000001564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000001564
Domain Number 1 Region: 361-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.49e-23
Family MAM domain 0.0048
Further Details:      
 
Domain Number 2 Region: 130-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000578
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 105-228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 58-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000001564
Sequence length 516
Comment (Anolis carolinensis)
Sequence
QSGVCRYGSKLDCCYGWKRNSKEHCEATCEHGCKYGECVMPNKCKCFPGFTGKTCSQDLN
ECGLEPHPCKHRCMNTHGSYKCYCLNGYMLMPDGTCTNSRTCSMVNCQYGCEEMKDDVRC
LCPSSGLQLSPNGKTCIDIDECATGKAICSFNRKCVNTFGSYYCRCQVGYELKYVNGRYN
CLDINECTANISMCNFHAECLNTQGSFKCKCKAGYRGNGFECSVIHENSVKEFPRISRVA
KEKLKKLLRHKNNLKNHVDMKNAIPEALATPPSRTHVRPLDYKENVGRNGNIDNKGADEE
EGESEHLENQIGHEKKLRGDVFLARSYKKSFGQSKESSGQCFYLLWMTSFSVSFCMFLDI
ISVDCSFGRGSCVWQQDANDDFDWSPANHENGDGYYMAVPVFMEHKKDVGRLKLLLTDLE
PKSMYCLIFSYRFAGERVGKLRVILSDISSGPSWEQSMGNGEWWKTGQIEMPTGAETTMN
ITFEAERGKGTTGEIGVDTVILFSGLCPEDHLALDI
Download sequence
Identical sequences 28377.ENSACAP00000001564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]