SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000001603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000001603
Domain Number 1 Region: 373-449
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000107
Further Details:      
 
Domain Number 2 Region: 145-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 39-111
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000001603
Domain Number - Region: 288-293
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000001603
Sequence length 456
Comment (Anolis carolinensis)
Sequence
METEQQEETFTNTETNGKFYCKRPAEDTEEEQAFKRSRNTDEMVELRILLQSKNAGAVIG
KGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGVQCLIPAA
DERPISHSDLQYCLVYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIK
LFQECCPHSSDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGF
TMMFDDRRGRPVGFPMRGRGGFDRMPPGRGRPMPPRRDYDDMSPRRGPPPPPPGRGGRGG
SRARNLPLPPPPPPRGGDLMSYDRRGRPGDRYDGMVSFVEKFDHTKTLSVKETSIKFEGG
SGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP
LEGSEDRIITITGTQDQIQNAQYLLQNRQQYSGKFF
Download sequence
Identical sequences 28377.ENSACAP00000001603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]