SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000002042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000002042
Domain Number 1 Region: 202-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-54
Family SPRY domain 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000002042
Sequence length 374
Comment (Anolis carolinensis)
Sequence
QEIMASCLKQLVLKQQQEKDNTKHIEEATNALKAQALASRTWLMGKFTELRLLFDEEEAL
TKRYIDEKVQQTLRAYEEQSEACKGQVETINSFVDRIRQIQLQPDPLLLLKEYSMIEKDM
LKQRIPAEQLAPVPVSFEHITNHFKRFLETIQSIFQKPLKARLREDVFSSLDSTLKKEPG
TLLKVNSCIDRSLFLKHARTPTLEMNSLHPRLTLSEDRLSVSYCWRRKFYPSNPQRFDKL
WQVLSRDSFSAGSHYWEVDLFQAEQGWWIGAAYPSIKRKGDSELCRLGCNRASWCIKRFE
LEYWAFHDGERIPIRTQNDPYRVGVFLDYEAGVLSFYNVTDGMAHLHTFHAKFTEPIYPA
VRVWEGTITIYKIT
Download sequence
Identical sequences 28377.ENSACAP00000002042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]