SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000002071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000002071
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily MIR domain 1.02e-24
Family MIR domain 0.0068
Further Details:      
 
Domain Number 2 Region: 801-914
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.79e-17
Family Galectin (animal S-lectin) 0.091
Further Details:      
 
Domain Number 3 Region: 1048-1173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000417
Family SPRY domain 0.029
Further Details:      
 
Domain Number 4 Region: 3621-3699
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 5 Region: 147-270
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000719
Family IP3 receptor type 1 binding core, domain 2 0.015
Further Details:      
 
Domain Number 6 Region: 380-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000127
Family SPRY domain 0.073
Further Details:      
 
Domain Number 7 Region: 1784-1853
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000693
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000002071
Domain Number - Region: 212-347,1530-1556,1638-1859,2133-2308
Classification Level Classification E-value
Superfamily ARM repeat 0.000326
Family MIF4G domain-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000002071
Sequence length 4573
Comment (Anolis carolinensis)
Sequence
WGQPFRVRHVTTGHYLALTEEKGLVVVDAEKANTKATAFCFRASKVRGEKLDVAPKREVE
GMGAPEIKYGESMCFVQHVDSGLWVTYAAADAKALRLGLLKRRAILHQEGHMDDALSLTR
CQQEESQAARMIYSTSGLYNQFINGKIKSSTPVNLPIDGMVLSLQDLINYFQHPEEELQH
EEKQTKLRSLKNRQNLFQEEGMITLVLNCIDRLNVYSTAAHFAEFAGEEAAEAWKEIVNL
LYELLASLIRGNRSNCALFSNNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQEN
HIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQTKLINYV
TSMRPNVFLGTHEGSTQYKKWYYELIVDYVEPFMSAQATHMRVGWAMAEGYSPYPGGGEG
WGGNGVGDDLYSFGFDGLHLWSGRVARPVTSPGQHTLGADDVVSCCLDLSVPSISFRING
FPVQGMFENFNLDGLFFPVVSFSAGIKVRFLLGGRHGDFKFLPPPGYAPCYEALLPREKM
RVEPIKEYKHDFNGVRNLLGPTQSLSHTAFTPYPVDTIQIVLPPHLERIREKLAENIHEL
WALTRIEQGWTYGSIRDDNRRLHPCLLDFHSLPEPERNYNLQMSGETLKTLLALGCHVGM
ADEKAEENLKKTKLPKTYMMSNGYKPAPLDLNHIKLTPAQNTLVDKLAENGHNVWARDRV
QQGWTYSMLQDIKNKRNPRLVPYSLLDERTKKTNRDSLREAVRTLIGYGYNIEPPDQETT
GQDLTKGRSEKVRIFRAEQFYAIKSGKWYFEFEAVTTGEMRVGWARPNVRPDVELGADEL
GYVFNGHRGQRWHIGSEPFGRPWQPGDVVGCMIDLIDNNIMFTLNGEMLISDSGSELAFK
DIEIGDGFIPVCSLGLSQVGRLNLGQDVSSLRYFTICGLQEGFEPFAINMKRDITMWFSK
SLPQFSQVPAEHQHYEVSRIDGTVDNPPCLKLTHRTFGSQNAIVELLFLRLSMPVEFHEK
ERATPCASIEAPRQRQQRSSIGGATEALYYYSVRIFAGQEPTCVWVGWVTPDYHQYDMNF
DLTKVRNVTVTMGDDKGNIHDSIKRSNCYMVWGGDFVSSTQQTRVSTVDLVIGCLVDLAT
GLMTFTANGKEVNTFFQVEPNTKLFPAVFVLPTSQNVIQFELGKLKNIMPISAAMFRSER
KNPEPQCPPRLAIQMLTPMTWSRMPNEFLRVDVARFSDRHGWMVECTDPNIMMALHIPEE
SRCIDILELSERLDLLKFHSHSLKLYCAVCALGNNRVAHALCSHVDESQLLYAIESSHLP
GLLRSGYYDLLIGMHLESAKRSRLMMNSEFIVPMTDQTKSITLFPDDTKKPGLPGVGMST
CLRPPLHFSDTFFVSTNYELYQLSPSIPLDILKVKAITMLTEAVQDGGQHTRDPVGGSVE
FQFVPVLKLICTLLIMGIFEDEDVRHILKMIEPYVFGEPKEEEAPEGAEEGEEPVEEEEE
EMVAAEAKEDEEGLEEGLLQMKLPESVKLQMCHLLQFFCDRELQHRVEAIIAFSERYMDN
LQTNQRQRYNTLMLAFTMSAAETARRTREFRSPPQEQINMLLNFKNGADQEECPVPEEVR
DELLEFHADLLAHCGIQAEGEEEEEEEETSLRRRLMSLVEKVKKEEAEEDQPPKEEPKPS
TLQELISHTMVHWAQESFIQSPELVRVMFSLLHRQYDGLGELIRAMPKAYTINANSVEDT
MSLLECLGQIRSLLIVQMGPEEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMV
NVLGGGDSKIRFPKMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGKQCMRGS
TPLDVAAASVIDNNELALALQEQDLEKVVTYLAGAGLQSCPMLLSKGYPDIGWNPCGGER
YLDFLRFTVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIQISQDP
ARDGPTVKKDRRRELFGGEETHEENRVHLGNAIMSFYAALIDLLGRCAPEMHLIQAGKGE
ALRIRAILRSLVPIEDLVGVISLPLAIPSFGKDGNVIEPKMSASFVPDHKAPMVLFLDRV
YGIDNQDFLLHVLEVGFLPDMRAAASLDTASFSTTEMALALNRYLCLAVLPLITKCAPLF
AGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEECLMALCRYIRPSMLQHLLRRLVFD
VPILNEFAKMSLKLLTNHYERCWKYYCLPTGWANYGISSEEELHLTRKLFWGIFESLSHK
KYDSELYKLAMPCLCAIAGAIPPDYVDASYSSKTEKKASVDAEGNFDPKPVETLNFDFGF
NISWKFSMSLYRDQNHALFFSFQIQNNWSFGEAYDEEAKTSPMLRPYKTFSEKDKEIYRW
PIKESLKAMIAWEWTIEKAREAEEEKTEKKKTRKISQTQRVHGYNPQPIDISGVTLSREL
QAMAEQLAENYHNTWGRKKKLELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQ
LNGYAVTRGLKDMELDTSSIEKRFAYGFLQQLLKWMDISQEFIAHLEAVVSSGRVEKSPH
EQEIKFFAKILLPLINQYFTNHCLYFLSTPAKILGSGGHASNKEKEMITSLFCKLAALVR
HRVSLFGTDAAAVINCLHILARSLDARTVMKSGPEIVKAGLRSFFEGASDDIEKMVENLK
LGKVSQSRTQVKGVGQNITYTTVALLPVLTSLFEHIAQHQFGDDVMLDDVQVSCYRTLCS
IYSLGTTKNPYVERQRPQLGECLARLAAAMPVAFLEPHINEYNPYSVYTTKSPRERAILG
LPNRVEEMCPDIPVLEKLMKEISGLAESGARYTEMPHVIEITLPMLCNYLPRWWERGPEN
NPQGPWCTDVTSDQLNTLLGNILKIIVNNLGIDEASWMKRLAVFAQPIVSKAKPELLRSH
FIPTMEKLKKRSGKVVAEEEQLRLEAKTESEDAELLIRDEFSVLCRDLYALYPLLIRYVD
NNRANWLTEPNLDAEELFRMVGEVFIYWSKSHNFKREEQNFVVQNEINNMSFLTADSKSK
MSKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCSPTDQELINLAKIRYSL
KDTDEEVREFLNNNLHLQDKSNSSSMRWQMALYKEMSGKAEDSNNPEKIVKRVQEVSAVL
FHLEQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRACNMFLESYKISWIL
SEEHPFEDRMIDDLSKPGEEEEEEEEEAEKKPDPLHQLILHFSRTALTEKIKLEVDYLYM
AYADIMAKSCHIIEGEEGEEESELSFEEKEMEKQKLLYQQSRLHNRGAAEMVLQMISACK
GEPGAMVSSTLKLGISILNGGNEEVQQKMLDYLKEKREVGFFQSIQALMQTCSVLDLNAF
ERQNKAEGLGMVTEDGTREKVMADDLFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTI
NIIICTVDYLLRLQESISDFYWYYSGKDVIDEQGKRNFSKAMAVAKQVFNSLTEYIQGPC
TGNQQSLAHSRLWDAVIGFLHVFAHMMMKLAQDASQIGLLKELLDLQKDMVVMLLSLLEG
NVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYITDPRGLISKKDF
QKAMDSQKQYTPSEIQFLLSCSEADENEMIDYEEFANRFQEPAKDIGFNIAVLLTNLSEH
IPHDNRLKTFLELAECIINYFSPYLGRIEIMGASKRIERIYFEISETNKTQWEMPQVKES
KRQFIFDVVNEGGESEKMELFINFCEDTIFEMQIAAQISEEEGQEEEEEDDEEGAEAGEA
EKASAPAEASSAFGEFLESVLNFFRMFTYRNIRRQFRKVKKMTVKEMAMGIATFIYTILM
GILFFLYNIFKGIFLLIWNTLFGGGLVEGAKKITMTELLASMPDPTQDEVHGDVAPSEEV
EQAVEEGEEIEIAEPGTEEAPAEGEDKKEHFRPMGADPPGGLGDMGDTTPVEPPTPEGSP
ILKRKLGLPTMTFSSGAENGEKAAKEEEEEKKKEEKGEEEPKEEIPTELVKEKKKVTQRE
KKESEAAGSEFWNELEIQRIKFLNYLSRNFYNLRFLALFLAFAINFILLFYKVKDFKMYC
FGGDDDGGDGNGNGNGDEDDEDSVVYYFLEESTGYMQPALQFLAIIHTLVAFLCIIGYNC
LKVPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNAPSFPSNYWDKFIKRK
VLDKYGDIYGRERIAELLGMDLASLEITAQNEKKTEPDKLTSQITSIDLKYKIWKFGVIF
TDNSFLYLFWYMVMSALGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLL
AVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDP
AGDEYELYRVIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIG
SDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPA
GDCFRKQYEDQLG
Download sequence
Identical sequences 28377.ENSACAP00000002071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]