SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003141
Domain Number 1 Region: 52-115
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000897
Family Canonical RBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003141
Sequence length 203
Comment (Anolis carolinensis)
Sequence
MTDESWDALFSDDGECLDPRLLEGLFARTPATTDLQEPRFDYYNYSPADLDLSDSELPHV
IEIYDFPAEFRTEDLMRVFCSYLKKGFDIKWVDDTHALGIFSSPITARDALTTKHLMVKT
RPMSQATRAAKTKARAYAEFLQPAKERPETSAALARRLVTGALGVRSKQSKEEREAERKQ
LQAARERKRLEAKQREDAWEGRE
Download sequence
Identical sequences 28377.ENSACAP00000003141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]