SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003266
Domain Number 1 Region: 2152-2452
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-128
Family BEACH domain 0.0000000000297
Further Details:      
 
Domain Number 2 Region: 2518-2811
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.66e-36
Family WD40-repeat 0.0098
Further Details:      
 
Domain Number 3 Region: 186-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-31
Family Clostridium neurotoxins, the second last domain 0.014
Further Details:      
 
Domain Number 4 Region: 2041-2146
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-29
Family PreBEACH PH-like domain 0.00000388
Further Details:      
 
Domain Number 5 Region: 490-570,649-944
Classification Level Classification E-value
Superfamily ARM repeat 8.83e-18
Family Plakophilin 1 helical region 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003266
Sequence length 2826
Comment (Anolis carolinensis)
Sequence
MASEDKQVSSPRPTGDDGGGGLGISSEMESNMQPLNPGVPIRGIRMKFAVLSGLVEVGEV
SNRDIVDTVFNLLVGGHFDLEMNFIIQEGESITCMVDLLDKCDVTCQAEVWSMFTAILKK
SIRNLQICTEVGLVEQVLERIDQADNMIADLLVDMLGVLASYSVTVRELKLYFSRLQGDK
GKWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMD
PVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLVVTSIKSKGKGFQHCVKFDFKPQKWY
MVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQ
MTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKGESDLFLADHHKQLLYDGKLSNAVAFT
YNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVVTHSIQSAMHSIGGVQVLFPLF
AQLDYRQYSLDQPDTTVCSILLAFIMELLKKSIAMQEQMLSCKGFLVIGYSLEKSSKAHV
SRAVLELCLAFAKYLSNLHHGVPLLKQLCDHILLNPAIWIHTPAKIQLTLYTYLSTEFIG
TANIYNAIRRVGTVLLAMHTLKYYYWVVNPQDRSGIIPKGLDGPRPNQKEILSLRAFLLM
FVKQLVMKDHGVKEDELQGILNYLLTIHEDDNLMDVLQLLVALMSEHPSSMIPAFDQRNG
LRVIYKLLASKSEGIRVQALKVMGYFLKHLAPKRKAEIMLGHGLFSLLAERLTLQTSLIT
MTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQVLKVIATLLRHSPQCPETIEVHR
VFLSDMIKLFNSSRDNRRSLLQCSVWQEWMLSLCYFNPKTSDELKITEMVYAIFRILLYH
AIKYEWGGWRVWVDTLAITHSKVSFEMHKENLSQMFREYQDKEDEDCGVGPSTIIRTVSG
TSREVEVAARQQHLEIKEIDISRNDVGCDDARNSTLRGDEGPSDFAEPTNSKVNEENGQG
SSDLNADPHLECSLPPETIQQNLGVTSTGTVETNHKEEIVTVSEAQTPSENTDGETLESP
EILEKLTPEVEEEEEDFVDLKEESNLPFTSEESVPKTNEHTTEEIQIAQAIPPLKEPILT
DSESKSVVASVERQQDPESLPETSASEFQPDSNAVEKISEENTDHPQNKTTTDNTPPNTS
EIVASEKKIAKLDVSSVASDTERLELKSNTTLEVNQPVRSIPETSRQQDPSGQSIGAVSD
GQRRDSRSTMFRIPEFRWSQMHQRLLTDLLFSIETDVQMWRSHSTKTVMDFVNSSDNVIF
VHNTIHLISQVMDNMIMACGGILPLLSAATSATHELENIEPTQGLSIEASVAFLQRLISL
VDVLIFASSLGFTEIESEKNMSSGGILRQCLRLVCAVAVRNCLECQQQHAVMKPSGENVK
CQKTAQSLIAAGKSGAKAMSPIDIVTGGISPIRDIDRLLQDMDINRLRAVVFRDIEDSKQ
AQFLALAVVYFISVLMVSKYRDILEPQDERRQRHTLKLFLTSLSKADADKAESPPGAITT
LTPVPAEESEIVASVQRRDSGIEEEAHSSLEHNSEVVTEEAQSVSAGPDAVSEVLCTLSS
EVNKSQESRSELQSEVDSNTSSLQAAKNVNVKDILRSLVSAPAGGAIVDPAILPPTFLGV
LGDGVAEQPVQFQSFDRSVVVAPKKSVASTTAAVNMPTNAVSVVSSMDSAQTPDAGLEKR
AGPPPKCLTGLNLYTPPPCPARTPSPTLYITERLEHALEKAAPLLREIFVDFAPFLSRTL
LGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQ
TMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRD
HVTATQLIQKIINILMDKHGAWGNSAPSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPE
ATLKAAIDHAPDEDVLVKGKQSIRSQALGNQNSESEILLEGDDDTLSSIEEKELENLTGP
VSLSTPAQLVAPCVVVKGTISITASELYFEVDEEESSFKKIDPKILAYTEGLHGKWLFSD
MRSIFSRRYLLQNTALEIFMANRVSVMFNFPDPATVKKVVNCLPRVGIGTSFGLPQTRRI
SMATPRQILKASNMTQRWQHREISNFEYLIFLNTVAGRTYNDLNQYPVFPWVITNYESEE
LDLTLPSNFRDLSKPVGALNPKRGAFFAERYETWEDEQVPKFHYGTHYSTASFTLTWLLR
IEPFTTFFLNLQGGKFDHADRTFSSISRAWRNCQRDTSDIKELIPEFYYLPEIFVNSNNY
NLGVMDDGTVVSDVELPPWAKTPEEFVRLNRLALESEFVSCQLHQWIDLIFGYKQQGPEA
VRSLNVFYYLTYEGAVNLNSITDSVLREAVEAQIRSFGQTPSQLLIEPHPPRSSAMQVSP
LMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPALANPAVITVTANRLFAVNKWHNLPAHQ
GAVQDQPYQLPVEIDPLIGLNTSMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWD
KSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYWNGKTNS
IGDYANGDSATPRAILTGHDYEITCIAICAELGLAISGSKEGPCLIHSMNGDLLRTLEPP
ENCLKAKLIQASREGHCVIYYDNGHFCVFSVNGKLQATMETDDNIRAIQLSRDGQYLLTG
GDNGVIMVWQVCDLKQLFAYPGCDAGIRSMALSHDQRCIMTGMASGSIVLFYNDFNRWHH
EYQTRY
Download sequence
Identical sequences 28377.ENSACAP00000003266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]