SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003358
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 9.35e-30
Family Phosphotyrosine-binding domain (PTB) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003358
Sequence length 117
Comment (Anolis carolinensis)
Sequence
EQMAAAAVRRILAMTRVGPKKFRKVVLTVSPRGLSLQDAETQEPIESISIYRISYCTTDK
LQNKVFAYVAQNPRSGALECHAFLSPKKKVAQAVTLTVAQAFQVALDLWEAAQAGKE
Download sequence
Identical sequences 28377.ENSACAP00000003358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]