SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003560
Domain Number 1 Region: 11-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-89
Family Calponin-homology domain, CH-domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 266-387
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-31
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 2159-2276
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-30
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 4 Region: 774-922
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-24
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1510-1661
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 1669-1774
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-23
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1723-1876
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-22
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 396-498
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 982-1136
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-21
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 10 Region: 1830-1986
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-21
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 11 Region: 604-720
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-20
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 12 Region: 500-606
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 13 Region: 1199-1347
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-19
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 14 Region: 1989-2050
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000417
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 15 Region: 1346-1460
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000849
Family Spectrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003560
Sequence length 2277
Comment (Anolis carolinensis)
Sequence
WDETTATAKLFECSRIKALADERDAVQKKTFTKWVNSHLSQVSCRINDLYTDLRDGYMLT
KLLEVLSGEQLPKPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGL
IWTIILRFQIQVIKIETEDNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFN
ALIHKHRPDVIDFRKLTKSNAAYNLQQAFNTAEQQLGLAKLLDPEDVNMEHPDEKSIITY
VVSYYHYFSKMKALAVEGKRIGKVLDQVLDIEKIIERYESLASELLEWIELTIAIISNQK
FANSLAGVQQQLQAFTAFCTLEKPVKFQEKGNLEVLLFSIQSKLRANNRKLYIPKEGRSI
SDINKAWTRLEKAEHEREVALRNELIRQEKLELLAQRFDHKAIMRETWLNENQRLVSQDN
FGYDLPAVEAAMKKHEAIEADISSYQERIQVVVELAQEMESESYYDSKRINAQKDNVLRQ
WGLLTELVSARRARLEQNLALQKIFQEMVYMIDWMDDMQAQLASKDYGKHLLEVEDLLQK
HSHLEADVSAQSERVQALNTAALKFSELEGYQPCDPQIICNRVNHVQSCLEQLQELAGKR
RKELEASRQLWSFFQEMEEAEAWAREKESILSSSQGYGKDLNSVAKLLSKHSILLGELGG
RRSLLQTAMRRGEQILLRKRFGPINIQEKIREVRLRWKKLEELSSSHLQKLQEALSFHQF
SADTEDLVVWLQDTYRLVSSDDFGHDEYSTQSLVKKHKGVVDEIDKHQTAVLALRKQLGA
LAPEYHELVDVQIRIVEVEQLYGEVVEVAVLRRQWLQDALAVYHMFSEVNACEVWIDEKE
QWLNRMDVPQKLEDVEVVQHRFESLDQEMNSLMGRILDVNQIVQQLVDGGHPSSSEVRAC
QDHLNSRWNRVVELVEHKKDHLNSILKIQNYLLECNEIKSQIQEKRKAVESTQYNSGDLG
SVLSLQRRLSTMEAALVVLEPRLIELQQEGELLANTHPAQAMEILMQFEEISEEWEALKR
TLQGCEDSLTVASRLQQFIQDLDSFLTWLVKTQAAVASDELPGNLSEAERLLNHHASLKE
EINRYEEDYTKIQAVNDVLALEEAELPYLSLQQWLQKLDVGWNKLLEMWENRREVLVQAH
IFFLFLRDAKQAEACLYNQETTLAHAKVPTTVEAAEKAIKKHKDFMTTMELNLQKTTTAL
KAGKSLIRQGNIYSEQVKEKMEALQAKSEKNVQRAQVWMQRLCDHLELQRFLQNCHEVAL
WLSCLLKYMDKLGHTDNRGLGYRWLRHRAFMAELAQNKEWLRKIEKEGQQLIEEKPELAE
TVRKKLGEIRQCWAELESTTQAKARQLLEATKADQLVQNYTDLDKRLLRMESQVHTIEPG
PDLTSVNSNLKKLQSMESQVEEWYKEVGELQAQVAGLPLEATSMEMVEERQNTVGTRIVR
LIEPLKERRRILLASKEVHQVSHDLEDEILWVQDRLPLATLKDHGSNLQTVQQFIKKNQN
LRREIQVHKPRMDDVLERATSIATIKSPEVDPVRLLLEKLSELWIALQEETERRQHLLDA
TYQVEQYYFDVAEVESWLSEQELFMMNEEKGKDEQSTLHLLKKHLMTEQTVENYAETIAQ
LSRQCRALLELGHPDSEQISRRQSQVDRLYVSLKDLVEERKAKLEQQYWLYQLNREVDEL
EHWIAEKEVVAGSPELGQDYEHVTLLQEKFTEFASETGSIGNERISAVNQMVDELIDYGH
ADAATIAEWKDGVNEAWADLLELMETRAQMLAASHELHKFFNDCRDVLSQIEEKKQRLPE
ITSRESKTSAGTLQRMLNSFEHDVQILVSQVRQLQEVAAQLRTVYAGENAEAIATKEQEM
MRSWKELLTSCEDCRLQITTTTDKMRFTSMVRDLISWMDTIICQIGTGEKPRDVSSVEVL
MNYHQGLKSEIETRNKNIAACVDLGKTLVLNKSPASEEIKLHLERLMTKKKEMVDKWDRH
WEWLQQMLEVHQFAQEAVVADAWLTAQEPLLKSRELGNSVDEVEQLIRRHEAFRKAAAAW
EERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKIFADPNEHSNKAATLLRQDTLRGRMEVQ
PLLNGSTEQDGPRHEHKATLADIVEQLQEKESTVPAPSATPPPTTSRRSRSAPAQSSAPP
PPPPTHTIQQEGYLLRKLELDGPNKKASNRSWINLYCVISKGELGFYKDSKGRESGSTHS
NEPLLNLHNATSEVANDYKKKKNVLKIKINDGGEFLLQAKDEEEMKTWLTALTSSIA
Download sequence
Identical sequences 28377.ENSACAP00000003560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]