SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003589
Domain Number 1 Region: 972-1099,1131-1337
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-75
Family p120GAP domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 37-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-36
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1562-1659
Classification Level Classification E-value
Superfamily RGC domain-like 1.96e-33
Family RGC domain 0.00000215
Further Details:      
 
Domain Number 4 Region: 634-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000178
Family Motor proteins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003589
Sequence length 1659
Comment (Anolis carolinensis)
Sequence
MSAAEESEGAARPHYGSVLDNERMTAEEMDERRLQNVAYEYLCHLEEAKRWMEACLNEEL
PPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNA
MAEIGLPKASIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EISNMRSELDKYGIQMPAFGKIGGILANELSVDEAALHAAVIAINDAIERQVPVDTLAAM
RNPNAMLVNLEEPLAPVYQETLYRAKQNKMENARNKIAAEDAARERDVYEELLTQAEIQG
NVNKVNTHSALSKIDLALDQGDAEALFRALSSASLGLRGLKHEHSDWYLKQLLRERELKQ
EAGKRGPLQKEELQAGVETANGSAQQYQQRLAAVRRINVAIHNGLPEKTVVELMNPEAQL
PPVYPFAADLYQRELATLQQQSPDGKLTHPELSVAVEMLSSVALINRALDAGDVDMIWKQ
LSSPVTGLTNVEDENLQRYIEELMRLKAEAQAEGTDFITWNDIQSCVDRVNVVVQEEHER
ILAIGVINEALDDGDAKKTLQALQIPAAKLEGVTPRVAQHYQDVLLRSKREKAQETRDET
AVLWLDEIQGGVHQSNRDTDEAQRFSLGILAINEAVDEANVGKTLSALRSADVGLYGVTP
ECADIYQQELAEAKRAKLAAGDNGSAWVKHWVKGGYHYYHNLQTKEGGWEEPQGFAQNNT
QLSREDIQSAISSVTAAYNREQLWVANESLIVRLQASCRGYLVRKEFSTRMHFLKKQLPA
ITCIQSQWRGYKQRKEYQDRLRFLQAHKDEAVKIQAMTRMHQARKRYRDRLQYFRDHIND
IVKIQAFIRANKARDDYKTLINAVDPPMAVVRKFVHLLDQSDQDFQEELDLMKLREEVVT
LIRSNQQLENDLNLMDIKIGLLVQNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQRGGL
KALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQRE
EYLLLRLFQTALQEEIKSKVDQLHEIVTGNPTVIKMVVSFNRGARGQNALRQMLAPAVKE
IMEDKSLNIKTDPVDIYKAWVNQMESQTGEASKLPYDVTPEQALSHEEVRTRLDVSLKNM
RTVTDKFLLAIISSLEKIPYGMRFIAKVLKDSLHEKFPDASEDELLKIVGNLLYYRYMNP
AIVAPDAFDIIDMSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQS
YQKFRRFFQAACEVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLFLDHQDAIAP
EHNDPIHELLDDLGEVPSIESLIGEGSGGMNDPGKEMLAKTEISLTLTNKFDVPVDENAE
MDAKTILLNTKRLIVDVIRFQPGETLAEILEVPASREQEAEHQRAMQRRAIRDARTPDKM
RTPQAAKEDSNLGLQEKKEKIRSGLKKLVELGLAKPQNGYQDLINDVAKDIRNQRRYRQR
RKAELVKLQQTQSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKK
ISLKYTAARLHEKGVLLEIEDLQSSQFKNVIFEIAPTEEVGDFEVKAKFMGVQMETFMLH
YQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences 28377.ENSACAP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]