SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003735
Domain Number 1 Region: 290-460
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-46
Family Ribonuclease PH domain 1-like 0.0000321
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-37
Family Ribonuclease PH domain 1-like 0.00016
Further Details:      
 
Domain Number 3 Region: 214-315
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.49e-24
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000311
Further Details:      
 
Domain Number 4 Region: 442-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.32e-24
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 5 Region: 131-221
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-21
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 6 Region: 541-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 7 Region: 621-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000137
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003735
Sequence length 731
Comment (Anolis carolinensis)
Sequence
RKLEISSGKLARFADGSAVVQLGDTSVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIP
TNYLRRELGSTDKEILTSRVIDRSIRPLFPAGYYYDTQILCNLLAVDGVNDPEVLAINGA
SAALTLSDIPWNGPIGAVRVGLIDGEVVVNPTRKEMSSSTLDLIVSSAPRSQVVMLEAAA
ENVLQQDFCHAIKVGVKHGQQIIQGIQQLAKEQGVPKRTVQKLFTAPEETVECAKQLASE
KITAVFSDFTHDKISRDEAINKIRLETEEQLKEKFPDSEPYEIMEAFNVVSKDIFRNLIL
NEYRRCDGRDLTSLRNISCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESSVKSDLITT
AISGIKEKNFMLHYEFPPYATNEIGKISSMNRRELGHGALAEKALKPVIPNEFPFTIRVT
SEVLESNGSSSMASACGGSLALMDAGVPISSAVAGVAVGLVTSPNSEKNGDIENYRLLTD
ILGIEDYNGDMDFKMAGTNKGITALQADIKLPGIPLKIVMEAIQQATVAKREILQIMNKT
IGKPRASRKENGPLVETVQVPLSKRARFVGPGGYNLKKLQAETGVTVSQVDEETFSIFAP
TPAAMHEAQEFITEVCKDDQDYQLEFGAIYTATITELRDIGVMVKLYPNMTPVLLHNSQL
DQRKIKHPSALGLEVGQEIQVKYFGRDPTDGRMRLSRKVLQSPASSVVKTLSDKNNIVMG
GSVPESATTTS
Download sequence
Identical sequences 28377.ENSACAP00000003735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]