SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000003925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000003925
Domain Number 1 Region: 199-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000569
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000236
Further Details:      
 
Domain Number 2 Region: 268-340
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000332
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000003925
Sequence length 661
Comment (Anolis carolinensis)
Sequence
GFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIGEGDEVEVYSRANDQEPC
GWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKAVNKNTFFKCAVEVPEDL
RDACANESAHKDFKKAVGACRIFYQAETTQLIVLSPSEATVKRVGILSDMHLRSIRTKLM
LMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELEE
DTGTFRIYGESAEAVKKARSYLEFVEDFIQVPRSLVGKVIGKNGKVIQEIVDKSGVVRVR
IEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQ
IGMGFRPSSTRGPEKEKGYTTDESTPSSVQGSRSYSGRGRGRRGPNYTSGYGTNSELSNP
SETESERKDELSDWSLAGDDERESRPQRDSRRRPPGGRGRSVSGGRGRGGPRGGKSSISS
VLKDPDSNPYSLLDNTESDQTADTDASESHHSSNRRRRSRRRRTDEDAVLMDGLTESDTA
SVNENGLDDRDKKPQRRNRSRRRRFRGQAEDRQPVTVADYISRAESQSRQRNLPREALAK
AKKEVAKDVIEEVVVPEKAINGPTVVPGTEPSKLQHSPEERPSTVQEDGNKQEEAVLNGV
S
Download sequence
Identical sequences 28377.ENSACAP00000003925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]