SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000004590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000004590
Domain Number 1 Region: 381-423,468-508,932-1090,1127-1194
Classification Level Classification E-value
Superfamily ARM repeat 0.000000672
Family Armadillo repeat 0.037
Further Details:      
 
Domain Number 2 Region: 582-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000121
Family Laminin G-like module 0.061
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000004590
Domain Number - Region: 131-236,381-486
Classification Level Classification E-value
Superfamily ARM repeat 0.00849
Family Clathrin adaptor core protein 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000004590
Sequence length 1584
Comment (Anolis carolinensis)
Sequence
RSMASKERLYELWMLYFAKKDLAKLQQWLEAFVANFEKIIAVHSLEPRRPEESVSEIPLL
PRDVLQVLTQQLAHCAGLPQALLLVKFFIIICRNLENVQAERPPVFVHEVVSLLSAYSKK
LKSPQSFPCKSQLEKVALYTLHLSECLFDPYQTWRRQLSGEIISMKEKSKYKFAPAVLPQ
EFNSFFQECFKDGEQLPEALQLRLIHLFGAIISGSKANALLAVTPSSVEVLMLVLRRWCS
PGSPPPAGDPNVLALALKSLVGMVHVLHAGSPPGQRKVEIRAILDSYFQVLNADQPGSPG
GQWEERLVALRVSMLAMFPQAMAVSAWPLLPTLVLLSQSFPRPNGVFLPSFCCLSDPSKA
SGSDLAMRLLSEADVHQVFDHTSDAIPIHAIRVLTSIMSGSPSAKEVFKERIGYSHLYEV
LKSQSQPTKKLLEELLNMAVEGDHGSFPMRPIHNEQPLLVLIQWIPELRSRDLRVFLSER
LKKICDASLRSRTTCVEAGMVGALLDALCAAEAEPLDGKCAENLLFLLRVLGGLSLRPGE
LRQLLRLLRTEPGKGAHPYVTQVVRALSGMARKEGPERALQYFDLSPSMAGIMVPAIQKW
PGSGFAFHAWVCLGDEAGRGEPPKEAPKLKRKQLYSFFTASGTGFEAFFTTDGMLVVAVC
TKKEYMTVALPEFPFNDAAWHCIDIVHITGRRPFGQNIVNIYVDGHLRKMAQMRFPSFGE
SFTSCCIGSAGHRTTTTSTIFPSPSHSPELGFPSHPSLSRSQSFPASLAPHSWAPLPPQP
PKEGLVSTMAAGSQDTEWGVPTSLEGHLGSASIFCEALPPAQVKALYAAGPNVTSPFKPE
GDFPEVSSKLLLYYTPQACKSNICLDLSPNHFYDGRLTGHKVVNWDVKDVVNCVGGMGVL
LPLLDQVASQKKEAEDPQETHNLVGPELTSSHNSAQGLLIPLGKSSESRLERNGIAAFLL
LVKNFIRGHAVNQESLVQCHGPAIIGALLQKVSSQAMDMNVLMASQVLMEQVALEGHSLL
QHLLYQYLLFDFRIWSNCDFAVRLGHIQYLSNIIKDHKQRIHRKYGVQYILDSIRTYYGM
CKEKAVATDDLRTVQTSLFSLVKDFLGRNFSAEEMQSTFNYLAAVNEEHQVCGMLEVIHG
LQKNSPSQEQIYAFLFEPGNVEILFSLLVQRKFSDEVRERIFKILYKLLKYEKVNERCKY
RLKLKDIGYQGLLSSLNDIPVSMLLFRCLLEQVLASDSPNYKDLMAVVYLSHRAELAVRL
DICRKLFHLIYAQHDMVKHLAKLAGWQDTLTKLYVKESYEGANPSRRTPSSPSTPSTWPA
IPPPPTTRTAPGRGSLVGEAVQADRVYHPLSPFSMCPFDLGLDVGSTSSVATAESGSQTP
VSLPGTPSPLESFKPFPGTRARKSSSLSNVLDDTSYQEALPSDNISNTSNPQQTPEEELC
NLLTNIIFSVTWRGVEGWDDVAWKERGQVFSVLTKLGSACELVRPPDEVKRSLLEMMMES
ALTDIKEATAAMLPSLTQNALKLLRLLQDFLFSEGHNNQALWSEKVYEGVNSLLDKLGVW
YHLANGTSDLKEMAQIGLRVLMGY
Download sequence
Identical sequences 28377.ENSACAP00000004590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]