SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000005121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000005121
Domain Number 1 Region: 55-134
Classification Level Classification E-value
Superfamily TNF-like 0.0000000059
Family TNF-like 0.0063
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000005121
Domain Number - Region: 22-62
Classification Level Classification E-value
Superfamily Stathmin 0.0353
Family Stathmin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000005121
Sequence length 149
Comment (Anolis carolinensis)
Sequence
GLVGPPGPPGPPGPPGAPGAEVTQEVLLQEFKEMLKEATERRSSPELPVAPSERVEEAFH
CKLKGQLVVDKKTLMELQNFQMPLAKGAFLRGSGLNLTTGRFTASISGIYQFSANVHIDH
SELKSKLQLRARDNIRVLICIESLCHRYT
Download sequence
Identical sequences 28377.ENSACAP00000005121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]