SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000005152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000005152
Domain Number 1 Region: 1-452
Classification Level Classification E-value
Superfamily Sema domain 6.8e-118
Family Sema domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 1302-1427,1623-1812
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-50
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 801-897
Classification Level Classification E-value
Superfamily E set domains 0.000000000000139
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 985-1089
Classification Level Classification E-value
Superfamily E set domains 0.00000000000028
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.086
Further Details:      
 
Domain Number 5 Region: 456-508
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000471
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 903-982
Classification Level Classification E-value
Superfamily E set domains 0.00000000000747
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 7 Region: 1086-1176
Classification Level Classification E-value
Superfamily E set domains 0.0000000315
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 
Domain Number 8 Region: 753-792
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000249
Family Plexin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000005152
Domain Number - Region: 602-642
Classification Level Classification E-value
Superfamily Plexin repeat 0.0116
Family Plexin repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000005152
Sequence length 1842
Comment (Anolis carolinensis)
Sequence
HLAVHHDTGEVYLGAVNRIYKLSANLTQLRAHTTGPVPDDPRCYPPPGVRLCAHRLSPAD
NVNKLLLVDYVGNRLVACGSVWQGVCQLLQLEDLTKLGEPHQRKEHYLSGGREPDAMVGV
IVEQPKEPSQFFVGTSIGGRSEYFPTLSSRRLTPNANSPEMFSLVYQDEFVSSQIKVPSD
TLSLYPAFDIYYVSAFVSGGFVYFLTLQLDTAQTPLEPAGGPRFFSSKIVRLCANDTEFY
SYVEFPLGCSKDGVEYRLVQAAQLAKAGQQLAQSLGIAEGQDVLYAAFSQGQKNRATPPR
ESLLCLFTLDEVNQHIRERIQSCYRGEGRLSLPWLLNKELPCINTPMQINGNFCGLVLNQ
PLGGLQVIEGRPLLEEKTEGMASVAAYTYRGHSVVFIGTRAGNLKKVRVDNPNEAHLYES
VPVMPGEPLLRDMVLSPDQRYLYLLSQKQVVRPVENCEQYLTCADCLGSRDPHCGWCVLH
NRCCRESECPRASEPHRFTSTLTQCVQLLIEPNNISVTEPSIVLHLTVHNVPDLTAGVTC
SFESLGESEGQLQVDGGIHCLSPTLRDEPPGEYVLWFGSQLQLLSKETGVEFASTNFVFY
DCSLLRTCLSCVSSHYPCHWCKYRHTCTHNVAKCFFLEGRVNTTEGCPELLPGGEILIPV
GVLQPITLRAKNLPQPQSGQKNYECVLGIQGRQQRVPAVRFNSSSVQCQNTSYWYDGEEV
GELPLDFDVIWDGDFAIDKPPGFKALLYKCSAQRSSCGLCLKSDPRYECGWCVPEHRCLL
RPHCPASRQNWVPPGRRGARCAHPRITQVLPLTGPKEGGTRVTVWGENLGLHFFEVGVRV
AGVRCSSLPAEYISAERLVCELEPSLLPDPPPGPVELCVGDCSADYRTQSDTPFTFVTPS
FYGVDPERGPTSGGTKISLLGTHLDAGSNVSVAIRGAPCRLIRRSAGEIVCLSPPSVLGP
GPANLSLRIDRANISTNGTISFRYSPDPVVTAIEPAWSIANGSTSLTVSGTHLLTIQEPR
VRAAYGGIETINSCQVLNDTVMLCKAPGIVPGEQALPLAGAHPNEFGFLLDDVFAVRTLN
RSAFTYYPDPSFESFGPSGILEIKPGSHVVLKGRNLIPAVSGSTRLNYTVLIGGEPCTLT
VSETQLLCDSPSQTGEQPVTILVGGLSFSPGTLHIYPEAALPLPALVGLGAGGSLLLGAI
IGVLVAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDINELTNNMDGVKIP
FLDYRTYARRVLFPGVDDHPALQETSVSAKQGRTCTEKGLRLFGQLLHTRPFLLTFIHTL
EGQRAFSMRDRGAVASLTMVALQGRLDYATGVLKQLLADLIEKNLQNRAHPKLLLRRTES
VAEKMLTNWFTFLLHRFLKECAGEPLFMLFCAIKQQMEKGPIDAITGEARYSLSEDKLIR
QQIDYKTLTLLCTPPEPPGGPAVPVKVLNCDSVTQVKEKLLDAVYRGGPYSQRPRAEDME
LEWCQGNGGRTVLQDEDATSKIEGDWKRLNTLGHYQVADGSAVALVPRQASGYNIASSFT
FTHSLSRYESLLRTSSSPESLRSRAPILTPDQDSGTRLWHLVKNHEHLGDPKEGERGSKM
VSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRASALPLPIKYMFDFLDEQAERRQIGDP
DVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKD
SPSTKLLYAKDIPVYKGWVERYYRDITKMASISDQDMDAYLVEQSRQHAGEFNTLGALGE
LYSYVGRYRDEILTALERDVACRKHKLRLKLEQVITLVSGNS
Download sequence
Identical sequences 28377.ENSACAP00000005152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]