SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000005401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000005401
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.9e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-33
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-31
Family Spectrin repeat 0.00000335
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.00000303
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-23
Family Spectrin repeat 0.00000241
Further Details:      
 
Domain Number 6 Region: 732-864
Classification Level Classification E-value
Superfamily EF-hand 2.14e-21
Family EF-hand modules in multidomain proteins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000005401
Sequence length 892
Comment (Anolis carolinensis)
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNA
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKM
VSDINNAWGCLEQAEKGFEEWLLNDIRRLERLDHLAEKFRQKACIHESWTEGKEAMLQQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTINPQEI
NSKWDHVRQLVPRRDQALMEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDAQGEAEFARIMSIVDPNRIGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITVDELRRELPPDQAEYCIARMAPYTGLDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences 28377.ENSACAP00000005401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]