SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000006003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000006003
Domain Number 1 Region: 376-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-36
Family SPRY domain 0.00098
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-18
Family RING finger domain, C3HC4 0.0099
Further Details:      
 
Domain Number 3 Region: 132-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000687
Family B-box zinc-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000006003
Sequence length 551
Comment (Anolis carolinensis)
Sequence
LKDNIMCPICLEVFKNPVTTACGHNFCIDCLQDYWDHQVLIGECPYCPQCREPFSSRPQL
RKNVTLGEIAMKFIREEAQESRKPASSREVPCDFCATRKLKAVKSCLQCMAALCDNHIRS
HYEDKTFKNHQLVDPLSDLKANICLKHRKLLELFCKIEGKFICQICMQEEHKNHEAVSLK
DERAKAEVEVRQIHANVGNQIFMLVADSQKHRGRVNYLEKVVKTARDEVNRAFADVLKEV
KRQQTKVMDFIDQEERNALVGMGNSIQHRQDQLGNLRRQNLWLATLIDESSDYQFLQDFP
KTKKMSGCAEALIGLKCEEPTSFVGLKQTLTDLKSQISMIGLCFINKVLQKGITVVPYEV
IPAPSDRRSLLKYYCTLNFDASTANEELFLFKETHSVLNMGILLENYSKPSQGFNHWPQL
LCTRSLCEGCHYWEAEISNTWLCLGVTYSYRHRTEKSCMFYLIGRNSNSWCLEWDSVKFS
VWHDNIQTVVQGNYYKTIGVLLNYTAGSLTFYGISNTMNLIYSFLTTFTEPLYPAAMVSS
GASVTLRQHKE
Download sequence
Identical sequences 28377.ENSACAP00000006003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]