SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000006068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000006068
Domain Number 1 Region: 1294-1433
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.28e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000135
Further Details:      
 
Domain Number 2 Region: 193-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000249
Family Calponin-homology domain, CH-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000006068
Sequence length 1439
Comment (Anolis carolinensis)
Sequence
ENVPEELREPFYTDQYDQEHIKPPVVHLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQA
LAQKGLYVTDQEKLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMISVEKVIACVQQYSS
FFQATDLPYDIEDAVMFWINKVNEHLKDIMEQEQKLKEHLSVETPGGQKSPSKWFWKLVP
ARYRKEQALLKQLPCIPLVENLLKDGTDGCALAALIHFYCPDVIRLEDICLKETMSLADS
LYNLQLIQEFCQEYLNRCCHFSLEDMLYAASSIKNNYLVFMAELFWWFEVVKPSFVQPRV
VVHPQAEPTKQASSLSDANANRRHYPDVSRDSELTARKASHRLVTHSGVPWATSLNTDYY
LSSCSIRRSSSMSYMDGYVGTWPKEKRSSVHGVSFDISFDKEDSMHIRTPKRGITRSLSN
EGLEQNANRMPRHIRKNISFKPVNGEEESDDIEEEKDVEFYSHLEDNSNQRNANQMNPYC
LPNGALQNRLVTDEFGNQIETPSIEQALQIIHDNEKSSGVTQPEQITNGFFLHNAEMSIL
NSNLKSNQTSPDIIADTKGALSPVTDNTEVDTGIHVPSDIPETMDEDSTLRDYTVSLDSD
MEESSRFLHEYDGRGSNHKELLSPCPSSVSAKSQAGSSASSSSGIKMTSFAEQKFKKLNH
TDSRSSGSSSQKTTPEGSELNIPHMVSWAQIPEESPVPQSRDTTQLLASEMVQLKMKLEE
KRRAIEAQKKKVEAAFTKQRQKMGRTAFLSIVKKKSDTISPFREEAAGAEDEKVFTDSTK
LKEKETPKPGEHLNKMAEMIKTSSEKPHVKWLKSPNTTVDTEKQCHLVSPSKDNLNEGDF
LEYTKSIEKLNSSLNFLQQEMQRLSLQQEMLMQMREQQAWVISPPQPSPQKQIRELKPSL
KFTGSSAPIAPFSVESPRPSHQSPQASSRKNSTLPVKMQRTPRPNELKLTPLNRTLTAPR
SVDSLPRLRRFSPSQASIQTRSFVYFGDDGERNLSKEVKTPGKEDTAKGEGGEKATEELD
EQKPEQQQLLKPLESTVSEVLSQPITEIVRLTPSEELLDPSSLLVPPPKTVNLIEVSLTD
LKPPEKSEEIVEKSEGESDKEQLEDDQKLCCGFFFKDDQKPENDMAVKRAALLEKRLRRE
RETLLRKQQLEAELETKKEETKRKSEEERQKKEDEKARREFIKQEYMRRKQLKLMEDMDI
IIKPRSHSAKQKKPRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESIQSGKRTPR
SESVEGFISPSRCGSRNGEKDWENASTTSSVASATEYTGPKLYKEPSAKSNKHIIQNALA
HCCLAGKVNEGQKNKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEISKLTGIGP
KSISKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQSKRPVTPKKLLPAKA
Download sequence
Identical sequences 28377.ENSACAP00000006068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]