SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000006219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000006219
Domain Number 1 Region: 12-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 124-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-40
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 3 Region: 543-565,768-931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-34
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 324-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-33
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 5 Region: 941-1145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.21e-27
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 6 Region: 550-608
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000549
Family Fibrinogen C-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000006219
Sequence length 1280
Comment (Anolis carolinensis)
Sequence
NCEDPLVFSLPETAFDSSSELSSTHSPSFAKLIKRDGAGGWSPLDSNREQWLQIDLGDRV
EITGVATQGRYGSSDWITSYSLMFSDIGRNWKQYQEEDIFWVFQGNTNADSVVQHKFLHS
VKARFVRFIPLKWNPSGNIGLRVEVFGCSYKSDIADFDGRSSLLYRFNQKLMSTFKDVVS
LKFKSMQGDGVLFHGEGQRGDYITLELQNGKLSLHINLGDAKLRFSNGHTTVTLGSLLDD
QHWHSVLIERFNKQVNFTVDKHMQHFRTKGDSDDLNIDYELSFGGIPVPGKPGTFLKKNF
HGCIENLYYNGVNIIDLAKRRKPQIYTGNVTFSCSEPQITPITFDSSNSSYLLLPGTPQL
DGLSVSFQFRTWNKDGLLLSTELSGDSGSLLLYLQHGRLALIIQKVAERHVAIGTGSNLY
DGLWHSVNINARRHRITLTLDNDVTSAVHATTVSQIYSGHSYFFGGCPHNFTDLKCLNPI
TAFQGCMRLIFIDNQPKDLILVQQGSLGNFSDLRIDLCGIKDRCLPNYCEHGGKCSQSWM
TFHCDCSETGYVGTTCHNSIYEQSCEAYRHQGKTSGIFHIDSDASGPLPPLLVYCNITED
KSWTIVQHNNTELTRVRGADPGKPYAMSFNYNSSMEQLEAVINSAEYCEQEAAYHCKKSR
LLNTPNGMPFVWWVGRANEKHPYWGGSIPGVQQCACGLEESCLDLRYFCNCDADKEEWTN
DTGFLSFKEHLPVNQIVITDTNRPNSEAAWRIGPLRCYGDRQFWNSASFLTETSYLLFPT
FHAEFSADISFFFKTAATSGVFLENMGMKDFIRVEISSPKEITFTVDVGNGPVEVIVQSS
LPLNDNQWHYLHAERNLKETSLQVDDLPKKILEAPTEGHFRLQLNSQLFVGTTASRQRGF
MGCIRSLYLNGQKLDIEERAKVTPGVKPGCPGHCSSYGNLCLNGGKCVEKFNGYLCDCTN
SPYEGPFCREEVSALFEVGTSITYVIQEPYPVTKNASSTSSAIYADTFNSKENIAFTFLT
AHAPSLLFYINASSQDYLAVILSKNGNLQVRYRLSKDRSLIFTIDSGNFANRELHHVKIN
RDGRELTIQIDQVLKVKHNFSSEADFRAIKSLTLGKIIDGQGLDPEVSKANSFGFIGCMS
SVQYNHIAPLKAALRHPSIAPVTVLGSLSESNCKALVALDVNTATTIYSSSDPFGKVDER
EPLTNAVRSDSAVIGGVIAVVIFIIFCIVAIMSRFLYQHKQTHRNNQTKEKEYPEHLESS
FKADVDLQNTVSECKREYFI
Download sequence
Identical sequences 28377.ENSACAP00000006219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]