SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000006963 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000006963
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily POZ domain 2.69e-25
Family Tetramerization domain of potassium channels 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000006963
Sequence length 200
Comment (Anolis carolinensis)
Sequence
QVVELNVGGEMFTTTLSTLKKHPGSKLAEMFAGGQSKLRTDSKGRYFIDRPGTYFKYVLE
YLRSNQVPNQCFQEVYKEALFYDIQPLIKQLEDSPPIFGELVARKQFLARVPSYTENIEL
MIRIARAEAVAARRSNVMVCAVKTEEDLARCHDTFNSLDTYKKSVVRFGPWNASPSISDL
LDCIKMDIEAKGYQITFQAY
Download sequence
Identical sequences 28377.ENSACAP00000006963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]