SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007376
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-82
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 332-439
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-21
Family Spectrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000007376
Domain Number - Region: 448-487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0125
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007376
Sequence length 488
Comment (Anolis carolinensis)
Sequence
FIDEREDVQKKTFTKWVNAQFAKFGTHPIEELFNDFQDGRRLLELLEGLTGQKLGKEKGS
TRVHALNNVNKALQILQKNNVDLVNIGSTDIVDGNHKLTLGLIWSIILHWQVKDVMKNIM
AGLQQTNSEKILLSWVRQSTQNYPQVNVINFTNSWSDGLAFNALIHSHRPDLFDWDSVVR
QQSAIQRLDHAFNIAKRHLGIEKLLDPEDVATAYPDKKSILMYVTSLFQVLPQQVTLEAI
QEVETLPRQLKHIREEHIQIHQQRFSQQIKVSVAQGHVRSPSPPSKPRFKSYAYTQAAYV
MSPDPKGKMFPPQHLGSHEEKLFATSPMDSEVDLESYQTALEEVLSWLLSAEDSLQAQGD
ISTDVEEVKEQFHTHEGFMMELTAHQGRVGDVLQVGSQLLSTGKLSEDEENEIQEQMNLL
NSRWENLRVTSMEKQNNLHRILMDLQNQQLSQLSDWLTKTEERTEKIESEPLGPDLEDLK
RQVEEHKV
Download sequence
Identical sequences 28377.ENSACAP00000007376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]