SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007545
Domain Number 1 Region: 1171-1398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.53e-39
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 526-648
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-33
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 208-320
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-31
Family Cadherin 0.00095
Further Details:      
 
Domain Number 4 Region: 635-747
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1421-1618
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-26
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 6 Region: 100-206
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.00092
Further Details:      
 
Domain Number 7 Region: 315-429
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 735-850
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 2-98
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-23
Family Cadherin 0.0034
Further Details:      
 
Domain Number 10 Region: 429-530
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 11 Region: 2215-2473
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000238
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number 12 Region: 1098-1188,1386-1434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000138
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 843-945
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000134
Family Cadherin 0.012
Further Details:      
 
Domain Number 14 Region: 1622-1655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000703
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1751-1791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 16 Region: 1662-1698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000962
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000007545
Domain Number - Region: 1800-1853
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000523
Family Hormone receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007545
Sequence length 2767
Comment (Anolis carolinensis)
Sequence
NYQVSIPENQPSGTVVIALEAHDPDEGEAGHLVYSIEAFFDKRSNDYFSINAGTGVVTTT
RSLDRETKDTHVLQVTATDQGAPRHRSATTFLTVTVSDTNDHGPVFEQPEYRENIRENLE
VGYEVLTIRATDKDAPDNANLLYRILEPGAGEGVFEIDPHSGVVRTCAPVDREEVSEYHL
VVEANDQGKDPGPRSATVTVHISVEDENDNSPQFSEKRYQVQIPEDTPINNQVLQVQATD
RDRGSNAQVHYSIVSGNLKGQFYIHSFSGSIDLINPLDYETIREYTLRIKAQDGGRPPQI
NSSGMVSIQVLDVNDNAPIFVSTPFQATVLENVPVGYSVLHIQAVDADSGDNARLEYKLI
EVAHPSSLVATVGDMSFPFQINNSTGWITVSVELDRETVENYHFGVEARDHGIPVMTSSA
SVSITVLDVNDNSPTFTEKVYQLRLNEDAVVGSSVLTLTAVDKDVNSVVTYQITSGNTRN
RFAITSQSAGGLITLALPLDYKQERQYVLTVTASDGTLFDTVQVHINVTDANTHRPVFQS
SHYTVSVSEDKPVGTSIVTIVATDEDTGENARITYVLEDNIPQFRIDPDTGTITTLMELD
YEDQASYTLAITAQDNGIPQKSDTTYVEILILDANDNVPRFLRDRYQGAVFEDVPLSTSV
LQVSAVDRDSGPNGRLLYTFQGGDDGDGDFYIEATSGVIRTLRKLDRENVAVYSLRAFAV
DRGSPPLKASVDIQVTVLDINDNPPVFEQDEFDIYVEENSPVGSIVARISAVDPDEGTNA
QIMYQIVEGNIPEVFQLDLLNGDLTALMDLDYESQTEYVIVVQATSAPLVSRATVHIRLR
DQNDNPPVLQDFQILFNNYVTNKSNSFPSGVIGKIPAHDPDISDHLDYTFVQGNELNLLL
LDSATGELKLSRDLDNNRPLEAIMKVSVSDGIHNVTALCTLRVTIITDDMLTNSITVRLE
NMSQEKFLSPLLALFVEGVATVLSTTKEGIFVFNIQNDTDVSSNILNVTFSALLPGGIRN
EFFPSEDLQEQIYLNRTLLTLISTQRVLPFDDNICLREPCENYMKCVSVLKFDSSAPFIS
SNSVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGNNGLCRSREGGYTCECYED
YTGEYCEVNARSGRCAPGVCKNGGTCINLLIGGFKCECPPGEYERPYCEMTTRSFPPLSF
VTFKGLRQRFHFTVSLMFATRERNALLLYNGRFNEKHDFIALEIIEEQIQLTFSAGETTT
TVAPFVPGGVSDGQWHSVQVQYYNKPNIGRLGIPHGPSGEKVAVVTVDDCDTAVAVRFGS
LIGNYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFVGCMRNLSIDSKQVD
MASYIANNGTLAGCLAQKNYCTSNWCQNGGSCVNKWNTYSCDCPLQYGGKNCEQVMTFPY
RFTGESIIIWSDLDITISVPWYIGLMFRTRKVNGMLMQANAGLSSKINIQILNKHVVFEV
YDGLNKIANLTMAQSRVSDGEWHHLLIELKSAKDGKDIKYLAVVTLDYGMYQSTVQIGNQ
LPGLKMKSIIVGGVSGDHVSVQQGFYGCLQGVRMGETPTNVATLNTEQATKIHVTEGCEV
DNPCDSNPCPLHSYCSDDWDSYSCICDPGFFGTDCVDVCSLNPCQHVSACVHKPSSSHGY
TCECGQSYYGQYCESKIDLPCPRGWWGNPICGPCNCEISKGFDPDCNKTNGECRCMANHY
RPQNSDTCYPCDCLPSGSQNRTCDNETGQCPCKAGVIGRQCNRCDNPFAEVTVHGCEVVY
NGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAVRHCNSEKGWLPPELFNCTTVGFMDL
KIMNEKLLRNETNMDGDKSVQIAKVLHSATNHTGSFYGNDVRTAYQMMIRVLQYESQQQG
FDLAATRDVDFNENIIRAGSALLEPSTKEHWEHIQRTEGGTAHLLKHYEEYFNTVAKNMQ
KTYMKPFIIVAANMIIAVDIFEKSNFTGAKVPRFDAIKEDYPRDLESSVLFPDTLFKASN
RKAVPTMKPANYIFPSKKGDEIFKKVLTKRKRRHPEESNQHATAIVIIYRTLGRFLPESY
DPDRRSLRLPNRPIINTPIISTIVYRDGESLPNLLESPITLEHVMMETEERTKPVCVFWN
HSTTIGETGGWSSKGCEMFSRSQSHVICQCNHLTSFAVLMDISKRENGEALPLKIITYTT
VSISLAALLLTFILLVLIRTLRSNLHSIHKNLVAALFFSELVFLIGINQTENPFVCTVIA
ILLHYFYMSTFAWMFVEQLHIYRMLTEVRNINFGHMRFYYVMGWGIPAIITGLAVGLDPQ
GYGNPDFCWLSVHDTLIWSFAGPIVIVVVINIIIFILAVKASCRRRQRSLEKTGIISVLR
TAFLLLLLISATWLLGLMAVNSDVMTFHYLFAVFSCLQGLFIFFFHCIFNKEVRKHLKNT
FTGKKPLPDDSTTTRATLLTRSLNCNDTYIEEPNMYRTTIGESTVSLESTVRDEAAQKLS
VSSSQARAGHTEGDSSIFRRKPSKSHEHDSDSDSELSLDEHSSSYASSHSSDSEEDAIDA
EKKWNAATSKSNDRGPLHSTPKVDSLPNHVKSYWPSESIAASDGEEPSAKQKLKVETKVN
VELHQENQANHSSEIPPDKENENKPFSQQNHQQPEQRKGILKNKVTYPPPLVDKNIKNRL
REKLSDYNQTTISSRMTAIGTNNGIRSNSDSGVTVKNPRRDQLPEQINGLAMNLHVGTGT
AETSDSE
Download sequence
Identical sequences 28377.ENSACAP00000007545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]