SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007676
Domain Number 1 Region: 133-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007676
Sequence length 372
Comment (Anolis carolinensis)
Sequence
MAAPEESERGMRSPKGKKASKVDESELLTVPDGWKEPAFKREDNPKGLLEESSFATLFPK
YREAYLKECWPLVQKALNEHHINAALDLIEGSMTVSTTKKTFDPYIIIRARDLIKLLARS
VPFEQAVRILEDDVACDIIKIGTLVRNRERFIKRRQRLIGPNGSTLKALELLTSCYILVQ
GNTVSALGPFNGLKEVRKVVLDTMKNIHPIYNIKTLMIKRELSKDPELRAQNWERFLPKF
KHKNLNKRKEPKKKNVKKEYTPFPPPQPESQVDKELASGEFFLKESQKKRKRVEEIKAKQ
AAAISKRQEERNKAFIPPKEKPAVKQKKAPSETKIDIEAIKEKVKKAKKKKLGALPVEEV
TLKIAADEKKKK
Download sequence
Identical sequences 28377.ENSACAP00000007676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]