SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007742 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007742
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-39
Family Laminin G-like module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007742
Sequence length 781
Comment (Anolis carolinensis)
Sequence
AEPADLLKVLDFHNLPDGISKTTGFCTSRRSSKGADVAYRVTKDAQLSAPTKQLYPGASP
FPEDFSILTTVKAKKGSQSFLLSIYNEQGIQQIGMEMGRSPVFLYEDHTGKPGPEDYPLF
RGINLSDGKWHRIAISVHQKNVTLILDCKKKITKFLDRSDHPIIDVNGIIVFGTRILDEE
VFEGDIQQLLLVSDHRAAYDYCEHYSPDCDTAVPDSPQSQDPSPDEYYTDGDGNLEAEGE
TYYYEYPYYEDTDDTGKAIPPTTQPVEIEEVARERTETTEEVAPPATQPPPVVESTLEEN
KEDEKVDDPLVDEYNYEPLPDEYYTPLPYEDLNYEDIDNLDKFTEEGVEAEVPTSTVITY
NETDPQGEANEDVDKDFTVDTIKEYEDGYYDVGDYDRTDSPDIGPGMPANQDTIYEGIGG
PRGEKGQKGEPAIIEPGMLIEGPSGPEGPAGLPGPPGTTGPMGPVGDPGERGPPGRAGLP
GADGLPGPPGTMLMLPFRFSGGGDGGSKGPMVSAQESQAQAILQQARLALRGPAGPMGLT
GRPGPLGPPGSTGIKGESGDMGPQGPRGVQGPPGPSGKPGRRGRAGSDGARGMPGQTGPK
GDRGFDGLAGLPGEKGHRGDSGPSGPPGAPGEDGDRGDDGEVGPRGLPGEPGPRGLLGPK
GPPGPSGPPGIAGMDGQSGPKGNVGPQGEPGPPGQQGNPGAQGLPGPQGAIGPPGDKGPL
GKPGLPGMPGADGPPGHPGKEGPSGEKGSQGPAGPQGPIGYPGPRGVKGADGVRGLKGTK
G
Download sequence
Identical sequences 28377.ENSACAP00000007742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]