SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007816
Domain Number 1 Region: 202-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000548
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000231
Further Details:      
 
Domain Number 2 Region: 271-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000991
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000007816
Domain Number - Region: 47-102
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0659
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007816
Sequence length 601
Comment (Anolis carolinensis)
Sequence
FLQAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPTGYNKDINESDEVEVYSRANEK
EPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFHKIKLDVP
EDLRQMCAKESAHKDFKKAVGAFSVVYDPEAHQLIILSINEVTTKRANMLIDMHFRSLRT
KLSLIMRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAID
LDEDTCTFHIYGEDQDAVKKARSYLEFAEDVIQVPRSLVGKVIGKNGKLIQEIVDKSGVV
RVRIEAENDKNIPQEEVCETRFSLLNRNTARGETFPELKVLLLTPVLYLMTSLTHAFLTL
QALVVSSTVAGRKQKPELKIWQGMVPFVFVGTKDSITNATVLLDYHLNYLKEVDQLRLER
LQIDEQLRQIGATSRPPPNRTDKEKGYMSTDDGPGLGRGSRPYRNRGHSRRGPGYASGTN
SEASNASETESDHRDELSDWSLAPAEEERDNYLRRGDGRRRGGGARGQGGRGRGGFKGND
EQSRTDNRQRNTRDTKGRTTDGSLQNTSSEGSRLRTGKDRNQKKEKSDGADGQQPLVNGV
P
Download sequence
Identical sequences 28377.ENSACAP00000007816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]