SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007904
Domain Number 1 Region: 338-423
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.49e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 194-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 113-189
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 426-518
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 2-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000282
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007904
Sequence length 521
Comment (Anolis carolinensis)
Sequence
RSRKIQIRNIPPHLQWEVLDGLLAQHGTVENVEQVNTESETAVVNVTYATKEEAKVAIEK
LSDHEFENYSFKISYIPDDEVSSPQPPQRSRRGGHSSREQGPSPGGSSQPKQLDFPLRIL
VPTQFVGAIIGKEGLTIKNLTKQTQSKVDIHRKENAGAAEKPITIHATPEGCSEACRMIL
DIMQKEAEETKSAEEIPLKILAHNSLVGRLIGKEGRNLKKIEQDTGTKITISPLQDLTIY
NPERTITVKGSIEACSNAEAEIMNKLREAYENDIVTVNQQANLIPGLNLNALGIFSTGLS
MLPSGTGVRRPAVSTPYNPFASQMAYLSGLYGALPSGAYPHQHSVPEQEVVNLFIPTQAV
GAIIGKKGQHIKQLARFAGASIKIAPAESPEASERMVIITGPPEAQFKAQGRIFGKLKEE
NFFNPKEEVKLEAHIKVPSSAAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVVV
KIIGHFFASQTAQRKIREIVQQVKQQEQKHPQGAPASQHSK
Download sequence
Identical sequences 28377.ENSACAP00000007904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]