SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008133
Domain Number 1 Region: 917-1044,1076-1281
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.63e-77
Family p120GAP domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 1509-1606
Classification Level Classification E-value
Superfamily RGC domain-like 4.71e-34
Family RGC domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-33
Family Calponin-homology domain, CH-domain 0.0000522
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000008133
Domain Number - Region: 696-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000117
Family Motor proteins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008133
Sequence length 1606
Comment (Anolis carolinensis)
Sequence
RWMEVCLDEELPPTTELEEGLRNGVYLAKLAKFFAPKLVSDKKIYDVEQTRYKRSGLHFR
HTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDL
LGKVDFTEEEISNMRKELEKYGIQMPSFHKIGGILASELSVDEAALHAAVIAINEAIEKG
VADQTIKTLKNPNAMLVNVDDGLAHAYQKELSEAKRRKEENARLKNGSILEEERDVYEEL
LTQAEIQGNLNKVNIHIALAQVNKAIDMQDEVALMAGLNHPALSLLEVLLQNSTWYLAQL
FDFKEQKTQVTEHNMLMWAKRQERILLEHGHTARKTYNNPLIAVDNINIAIRNCDPNKTV
AALMKPEAQLCEVYPSAAPVYQTELFNLQQQNAVNYLAHDELSIAVEMLSAVVLLNQALE
NKNIVEIKTHLSNPSIGFNNLEDENLQRYADTLMSIKLEASSQGQKYLSWNDIQNCIDMV
NTQVREENDRIVAIGHINEAIDGDPRRTVEALLLPTAKLHEVKEENAWHYQEVLRNAKAD
KCQECHDDSSLLWLDEIQKGIEDANRNLEGASKLAVGTTEINQCLEEGNSAQIITIVQSP
NFHLRTVPECAETYYSSLLDAKSLKPKDPDEGPWINILMQGLYDYYYNVETGMGTCVPPE
GIVPKTSWLTGEEIKDIVNQITSDYNRKQLWFANEDLIIQLQARARGFLIRKKYNERKAY
LQTQEPSVIKLQACWKGYKQRKIYSERLETLQRNVASVIKIQAWVKMWLARRAYKKRLQY
FKDHNDEIVKIQAFLKANKAREDYRILTGSENPPLNVLRKFAYLMDQSDLDFQEELEVTR
LREEVVTNIRSSQQLEKDLNLMDIKIGLLVKNRITLQDVISHSKKLNKKSKNQMEEMVTG
DKQGIKGLSKERRKKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDTVIFTLYNYA
SNPREEYLLLKLFKTALEEEIHSKVDQIQDIVTGNPTVIKMVVSFNRGARGQNTLRQLLA
PVVKEIMDDKSLVINTSPVEVYKAWVNQLEMQTGEASKLPYDVTTEQALTHPEVVNRLES
SIQSLRAVTDKVLTSIFSSLNLMPYGLRYIAKVLKNSLHEKFPDATEDELLKIVGNLLYY
RFMNPAIVAPDGFDIIDMTAGGQIHSEQRRNLGCVAKVLQHAASNNLFEGENAHLSSMNS
YLSQTYEKFRNFFQAACVVPEPEEKFNIDEYSDMVTLSKPVIYISIEEIINTHSLLLEHQ
DAIAPDQNDVLNELLQGLGEVPDVDTFLGEGTIDPNDPNKESTLSQLVKTEISLSLTRKY
DLREGEEQDIKGLMMKTKRLIIDVIRAQPGESLAKILETPATELQEAEHLKVIEKRALLD
SKTPEKMKHSRSILEEGQLPLEQKKRKIQRNLRTLEQAGLVSSENKYQDIINEIAKDIRN
QRRYRQHRKAELVKLQQTLNALNSKKAFYEDQVNYYNTYIKTCLDNLTRKSIKLNGKQEE
KGNKLKNVSLKYTAARLHEKGVILGIDDLQPNQFKNVMFDISPGEEVGDFDIKAKFLGVE
MEKVQLHFQDLLQMQYEGVSVMKMFDKAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences 28377.ENSACAP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]