SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008228
Domain Number 1 Region: 39-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 2 Region: 164-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000166
Family Pentraxin (pentaxin) 0.0076
Further Details:      
 
Domain Number 3 Region: 846-1135
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000087
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008228
Sequence length 1245
Comment (Anolis carolinensis)
Sequence
MSYENQMWWCYQWKWKLHLLFLFVLYLMCVQCSALRCSDCRMVLSNPTGIFTSPCFPNDY
PNSQACKWTIRAPSGFIIQITFVDFEIEEAPNCIYDFLRLHTGEKEVTLCGITARGLSFN
SSGNEMIVSFTSDFSIQKRGFNASYTRVAVALRNQKVIIPQFWTDTVSLANSIQVPELNQ
FTLCFEATENNGSSHNWKAFSYCDSSATEFFSFGKTKGGHFIFISDTECMLNDALDTNPD
GDFFTETFEQLCIVWDSYSGTIGVNVKHTYKTVFCSDSYGKVIPANGKLVLGSDRKDINP
LNGDIYNFRLWNFTMNSQVLSNLSCDVKGSIIDWETDFWSIPTSALKAENNLSCGSYLIP
LPTVEPTSCANLGGVCQASVNSTTTSPTVTTNMPDTNRTDKQTDGGLFYRIAFTVYSDKD
ISESNVQSAVANWLNHTFQDWNYTVYVVNISIQPSAMKDRAREKRNVDHQSFDVRALLVY
NATNNISLEEQTIERKLESNNVSIGNGWRVKKVDVHPVEKCENEENPPNYIWADTRPTVT
ESILCHGSSTQIASRVCLLNLDNFTSYWGPPDLRNSFKNAADIANQLLNLTGEGQQLTSD
KVNDVIQKLKKIVNDEEINESLGSTVVTIFSNILTSSDSVLAASSSEAIKTIDALALKIQ
FTGPSMSISAKNLALGVSLLNSTSFTGSSFSVGTQNNASDFQIDFDKNQENSLASVALPE
SLLKNLSQEDIEIVSRAQFTFFNKSGLFQDAGSNTSLISYVVACSIGNITIRDLQDSVRI
TIKHTKTSNPTCAFWDMDKNKGLGGWNKTGCVLQAASSDDETVCLCSHLTHFGVLMDLPG
TAPQIDPENTKALTFITYIGCGISAIFSAATLLTYIAFEKLRRDYPSKILMNLSTALLCL
NLAFLLDGWIASFDIEGLCIAIAALLHYFLLATFTWMGLEAVHMYIALVKVFNTYIRRYI
LKFCIIGWGLPAVVIIIVLASTNANASRIYNKDLYGKNTKGQGGDEFCWIQDNTVFYLTC
VGYFGIMFLMNIAMFVVVMMQICGRNGKRSNRTMREEILRNLRSVISLTFLLGMTWGFAF
FAWGPLYLPFMYLFCIFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFKLADNSDWSKT
ATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSTCNTFLKRNSHSDNVFLDKASPKYIQ
VDTEQSSIIPVHQVIDKVKGYYNTHSDNFYRNIIMSDSLSHSTKF
Download sequence
Identical sequences 28377.ENSACAP00000008228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]