SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008338
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.2e-54
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008338
Sequence length 172
Comment (Anolis carolinensis)
Sequence
PVTDLEIRFAYRGRSVGSLTISNPHGCRLFYSHLEPTQEQVELFGPVTLEQVRLPSAEAV
PHEKQRFYTHQLLDVLDRGLLLELQGQDIYAVRLCQCKVFWTGPCAGALDGPNPIEREKK
VKLFSLESFLNGLIMFQKGQSTTPPPYEIFFCFGEEWPDRKPKEKKLITVQV
Download sequence
Identical sequences 28377.ENSACAP00000008338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]