SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28377.ENSACAP00000008375
Domain Number - Region: 184-248
Classification Level Classification E-value
Superfamily t-snare proteins 0.00196
Family t-snare proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008375
Sequence length 256
Comment (Anolis carolinensis)
Sequence
MATLCMEESIYNLLPKIVDKPLKAPRYISTFKPHVKRTIEQSKAPWKTIGPARVQVPSPK
DFLKKHSKEPKLPKRKKDKDSLKTIEASVPKITDHPIMGVQCTKNFISSNAANVIMGVAK
KPQQICVDRRQGDKFVLETSGLLPKYLKKKDYGVTPKYVTKRTEEARRAQEEYDAYVKES
LRQRAMKRLSDEERESLLRGLKKNWEEVHQAFQSLSVEIDTLPKKLHKERLETEMKQLEH
DIQTIEKHKVIYIANK
Download sequence
Identical sequences G1KHX8
ENSACAP00000008375 XP_003222203.1.98722 XP_003222204.1.98722 ENSACAP00000008375 28377.ENSACAP00000008375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]