SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008506
Domain Number 1 Region: 28-193
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-43
Family Dual specificity phosphatase-like 0.000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008506
Sequence length 217
Comment (Anolis carolinensis)
Sequence
MSSTALKSGKISAYAAVKVDPDGDYCTPGAFDLERLFWKGSPKYTHVNEVWPNLYIGDEK
TALDRYSLEKAGFTHILNAAHGRWNVDTGPEYYSDMNIEYHGVEADDLPTFNLSPFFYSA
AEFIHTALQNETNKILVHCAMGRSRSAALVLAYLMIYKNMTVVDAIDQVLQHRCILPNRG
FLKQLRELDIKLALERRDNMNGTNSSEKTGTSTETEI
Download sequence
Identical sequences H9GE74
ENSACAP00000008506 ENSACAP00000008506 NP_001268642.1.98722 XP_008112428.1.98722 28377.ENSACAP00000008506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]