SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008614
Domain Number 1 Region: 3106-3344
Classification Level Classification E-value
Superfamily Plakin repeat 3.53e-88
Family Plakin repeat 0.0000000474
Further Details:      
 
Domain Number 2 Region: 3685-3921
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-87
Family Plakin repeat 0.0000000225
Further Details:      
 
Domain Number 3 Region: 2447-2687
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-86
Family Plakin repeat 0.0000000676
Further Details:      
 
Domain Number 4 Region: 2775-3015
Classification Level Classification E-value
Superfamily Plakin repeat 6.15e-78
Family Plakin repeat 0.000000166
Further Details:      
 
Domain Number 5 Region: 3443-3678
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-76
Family Plakin repeat 0.00000062
Further Details:      
 
Domain Number 6 Region: 3995-4036,4071-4266
Classification Level Classification E-value
Superfamily Plakin repeat 1.48e-68
Family Plakin repeat 0.000000298
Further Details:      
 
Domain Number 7 Region: 75-191
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-24
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 417-520
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-17
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 9 Region: 959-1134
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-16
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 10 Region: 1-63
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000334
Family Calponin-homology domain, CH-domain 0.0000444
Further Details:      
 
Domain Number 11 Region: 3942-4000
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000706
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 12 Region: 324-415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000114
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 894-1002
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000048
Family Spectrin repeat 0.0083
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000008614
Domain Number - Region: 523-595
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000301
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number - Region: 658-771
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0662
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008614
Sequence length 4334
Comment (Anolis carolinensis)
Sequence
RPMLIDMNKVYRQTNVENLEQAFSVAEHDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYD
AMPRVPDVQDGVKANELQLRWQEYYEVVTLLLQWMRHHTLVFEERKFPASYEEIEILWRQ
FLKFKETELPAKEADKNRSKAIYQSFEAAVQSGQVKVPPGYHPLDVEKEWGKLHVAILER
EKLLRSEFERLERLQRIVSKLQMESGLCEEQLNQADTLLQSDIRLLNAGKAPQKSAEIER
DLDKAEAMIRLLFNDVQALKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKSGSAPVV
QTSVLVTQQQRVRPELDDVTLRYLQDLLSWVEENQQRLGAAEWGVDLPTVDSQLGSHRGL
HQSIEDFRPKIERARADEAQLSPGPRGAYRDLLGKLDLQYAKLLNSSKARLRHLESLQAF
VAAATKELMWLNEKEEEEVTYDWTERNGNMAAKKESYSGLMRELEQRERKIKEIQGTGDR
LLQEGHPAKQTVEAFQAALQTQWSWMLQLCCCIEAHLKENNRFQFFSDLKEAEESLRKTQ
ETMRKKFVCDRSVTVTRLEDLLQDSQDEKEHLAEYQAHLAGLAKRAKTIVQLKPRSPSSP
VKGRLPIQAVCDYKQMEITVHKGEACSLLNNSQPHKWKVLNAAGSESVVPSICFVVPPPN
KEALDAVSRLEGTHQGLLTLWHQMHIDLRSLLSWQHLQRHIQQIQSWTLLTFRTMPPEEY
RQVLRSLETHYQEFLRSSQDAQNFLPDDRLQVEREVTSCNQKYELLLRGLEKGEQEESLC
RNYISQLKDIRLQLEGCESRTTHKIRLPLDKDPAKECTQRITDQQQIHQELEGIKKSLGK
VSAKTEQVLAQPEKAGSAPSLHSELDLTLQKMDQVYSLSSIYLEKLKTIHLVIRSTQGAE
DLVRKYEEQLKDVQAVPADVKALEDTKAELKRLRRQVEGHQRLFNTLETDLGRASEVNER
MVRGHSERDIDLDRYRERVQQLLERWQAVLAQIDLRQRELDQLGRQLRYYRESYDWLIQW
IQDARQRQESLQAVPIAGSKNVRDQLLQEKKLLEECDRNREKVEECQRFAKQYIDAIKDY
ELQLVTYKAQVEPVVSPAKKPKVQSASDSIIQEYVDLRTQYSELTTLTSQYLKFITETLR
RLEEEERVAEKLKEEEQQRLAEVEAQLEKQRQLAEAHARAKAQAEREAQELQRRMEEEVS
RRQLVAVDAEQQKQTIQQELSQVKQSSDTQIQAKLKLIEEVEFSRKKVEEEIHLVRLQLE
ASERQKTGAEEELRALRERAEEAERQKRLAQEEAERLRKQVKDESQKKKEAEDELKRKVQ
AEQQASREKQKALDDLQKLRMQAEEAERRMKQAELEKERQIQVAQEVAQKSAEVDLQSRR
LSFAEKTAQLELSLKQEHITVTHLQEEADRLKKLQLEAEHSREEAEKEVEKWRQKANEAL
RLRLQAEEVAHVKALAQEEAEKQKEDAEREARKRSKAEESALRQKELAEQELEKQRKLAE
GTAQQKFQAEQELIRLKAEVENGEQQRLLLEEELFRLKNEVSEAIQKRKELEEELAKLRT
EMELLLQSKAKTEEESRSTSEKSKQILEAEANKLRELAEEAARLRALSEEAKRQRQLAEE
EAARQRAEAERILKEKLVALNEASRLKAEAEIALKEKEAENERLRRLAEDEAYQRRLLEE
QAAQHKQDIEEKIAQLKKSSENELQRQKGLVEDTLKQRRIVEEEIRILKVNFEKASLGKT
DLEVELNRIKQSAEEIQRSKQQAEREAEELRQVALEQENHRREAEATVKKIAAAEQEAAR
QCKAALDEVERLKAKVEEARKQKELAEKESERQIQLAQEAAQKRIKAEEKAHLATVQQKE
QELMQTRQQEQSALDKLREAAEQAKKAAEEAELARIKAEKEAALSRQLVEEAERMKQRAE
EEAQAQAKAQEDAEKQRKEAELEAAKRAQAEQAALKQKELADAEMAKHKKFSEQTLRQKA
QVEQELTKVKLQLEQTDHQKNILEEEQQRLKDEVTEAMKQKAQVEEELFKVKIQMEELIK
LKTRIEGENKALIMKDKDNMQKFLAEEAEKMKQVAEEAARLSIEAQEAARLRELAEQDLA
QQRALAEKILKEKMVAVQEATRLKAEAEMLQKQKDLAQEQAKKLQEDKEQMQLRLTEEAE
GFQKTLEAERKRQLEISTDAERLKVQVTELSLAQAKAVEEAKRFKKQAEEISQKLHQTEL
ATREKMTLVQTLEIQRQQSDQDAEKLKKAIAELEQEKEKLKREAERLQQKSEEMQTAQKE
QLRQETQMLQKTFLSEKDVLLQKERFVEEEKAKLEKLFQEEVKKARDLTAEQERQQKQME
QEKQKLAAVLEEARKKQAEAEENVRRKQEELQQLEKLRQKQEKLLAEENQKLRERLERLQ
EEQRAALSQTREIMIQTDDLPQELKAVPNGQDLTDGISQNGEAELAFQGLRHKVSAKKLA
EAGILSRENFEKLAKGKATVEELSQREDIRRYLRGTSCIAGLLLKPSNEKMSIYTAMKQQ
VLSPGTALILLEAQAASGFIIDPVRNKTMSVSEAVKEGVIGPELHNKLLSAERAVTGYKD
PYTGEKISLFQAMTKDLIVKDHGIRLLEAQIATGGIIDPVNSHRLPVDVAFKRGYFDKAM
QKVLSDPSDDTKGFFDPNTQENLTYLQLMERCVADPKTGLFLLPLTDKAAKGRELVYTDQ
EAKDVFKKATVSAPFGRFQGKTVTIWEIINSEYFTAEQRRDLLRQYRTGKITVEKIIKVI
ITVMEESEKKSQLCFEGIRAPVPASELLESKVIDKDLYNQLHQGKKTVEELANVDPIKKY
LKGTGAIAGILVESSGQRLLLNDALKKNLLKPEIALMLLEAQAATGYIIDPVRNEQLPVD
DAVRSGIVGPELHEKLLSAEKAVTGYRDPYTGQVVSLFQAQQKGLIPKDTGIRLLDAQLA
TGGIIDPVNSHRLPVDVACKRGYFSDEMNKALSAPADETKLYYDPNAQENLTYAQLQKKC
QVDMKTGLCLLPLSDQAVRLQQEEIYSDSQAKQSFDKATVEVPAGSLKGKTVTIWELIHS
EYLTEEQRRELIRQYKTGKVTIERVIKIIITIIEETETKKQEKLTFSGLRAPVPASELLE
SKVLSKKQYEQLKDGKKSVKDLAEVASVKRYLQGSDCIAGVYVEETKEKLNIYEAMRRAL
LMPSTATVLLEAQAATGFLVDPVKNQKLSVHEAVKAGIVGPELHEKLLSAEKAITGYKDP
YSGNTISLFEAMRKGLILKEHAIRLLEAQIATGGIVDPVHSHRLPVEVAYKRGYFNEEMN
RTLLDPTDDSKGFFDPNTKENLTYLQLKERCIEDPETGLYLLPLRQPETPTVVETTQVYT
EAETKKVFEETQIDIPSGDNAGSSMSLWEIMHSGLIPEEQRKRLMDEFRSGKVTKERMII
IIIEIIEKTEIIRQQDLTSYDFVRRRITAEDLYEARIISVEIYNALKQGSQTIREILEIE
TVWKYLYGAGCVAGIYIPSSKQKLSVYQALKRGMITPEVARPLLEAQAATGFIVDPTKNE
MLTVDEAVRKAVVGPEMHDRLLSAERAVTGYRDPYSEKKISLFQAMKKDLIPSEEALRLL
DAQLATGGIIDPHLGFHLPLETAYQRGYFNRETYERLSEPSEIRSYIDPSTDEKLSYAQL
LKRCKKDENTGCLLLHISDTRKLSFRGLRKQISVEELVRSKVMDEATAQRLQEGLTSVEE
VSKVLKNFLEGTSCIAGVYMDASKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPI
KGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGI
RLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILLDPSDDTKGFFDPNTEENLT
YLQLMERCITDPETGMCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRK
GLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAISKGLIDQSALD
QYRSGSLSITEFADMLSGNVSGFRSRSSSVGSSSSYPVSPAHVRAQLASWSDPTEETGPV
AGILDTDTLEKVSITEAMRRNLVDNITGQRLLEAQACTGGIIDPSTGQKFAVADAVNKNL
VEKIMVDRINLAQKAFYGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEP
EATGRVSLDEALQKGTIDARTAQKLRDVNTYSKYLTCPKTKLKISYKDAMEKSMIEEGTG
LRLLEASSQSSKGYYSPYNVSGSGSASGSRSGSRTGSRSGSRRGSFDATGGSGFSMSFAS
SSYSSSSYGRRYTS
Download sequence
Identical sequences 28377.ENSACAP00000008614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]