SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000008892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000008892
Domain Number 1 Region: 47-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000396
Family Eukaryotic type KH-domain (KH-domain type I) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000008892
Sequence length 130
Comment (Anolis carolinensis)
Sequence
DEFAVSEEAQEVVTQHRPRIEQLFGVELNGPGGDFPGARKIWLQLQGHGDNLQRAKEYIK
GLCAPELTEEVYYPKDMQCIFLGAHGLFLNCLTQGTSAHITCLRPGVLLISGLAEAFVMA
QSRIQEFVEK
Download sequence
Identical sequences 28377.ENSACAP00000008892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]