SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009096
Domain Number 1 Region: 44-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-28
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 261-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 308-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family Laminin-type module 0.059
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000009096
Domain Number - Region: 4-21
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009096
Sequence length 340
Comment (Anolis carolinensis)
Sequence
SDTENWFCECSPLYSGKLCQFSTCAETPCGNGATCVPKSSQDTICLCPYGRTGILCNDAI
NITYPSFSGIDAFGYTSFLAYSAILNISLHYEFHLKFQLSNSNSSIQDNLIFFTGQKGQG
LNGDDFLVLGLRNGSVVYSYNLGSGTATIISETLDLTRQIHIVSLGRSLQDGWMKVDDQE
NKTITSPGKLVGLNVFSQFYVGGYIEYIPELLPYGSIFKNGFQGCIFYIQVRSGRAQQFK
APGIPEGHPNAGRNIGQCEESPCQLIKCKNGGTCVESGSTLYCHCPTGWKGAFCTETVSV
CDPEHNPSPKCQQGSTCVPLPDGYSCHCPLGTTGVHCEQG
Download sequence
Identical sequences 28377.ENSACAP00000009096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]