SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009191
Domain Number 1 Region: 380-609
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-33
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 76-231,371-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.16e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.084
Further Details:      
 
Domain Number 3 Region: 684-714
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000999
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000009191
Domain Number - Region: 715-739
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0855
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009191
Sequence length 1052
Comment (Anolis carolinensis)
Sequence
SHSLFDAFLHAKQCKEVLDNFEAFCRHLGLEHTGQLQFYHKLKSCLNYWSAKALWTKLDK
KAGHKDYDQGTACANTKCLIIGAGPCGLRSAIELAFLGAQVVVLEKRDTFSRNNVLHLWP
FTIQDLRTLGAKKFYGHFCTGSLDHISIRQLQLILLKVALLLGVQIHTNVQFKGLVPPTA
SSISGWRAVLHPSSSPLSQYEFDVLISAGGGRFVPEGFKRKETRGKLAIGITTNFINNHS
RAEVEVAEISGVARIYNQKFFQNLNNKTGIDLENIVYYKDDTHYFVMTAKKQSLLKKGVI
LKDKLDIESLLSPKNVNQEALLAYAKEAANFSTNYKLPNLKFALNHRNQPDVDMFDFTCM
SRSDNAALVRDCKGKKLLIGLVGDCLVEPFWPLGTGVGRGFLAAFDAAWMVKRWASGTPP
LDVLAERESLYQRLSQTSPDNTNKNINQYSIDPITRYPNINLQAIKASQVRNLYVTGEIE
TDQKKRRTSMEKSSFPEAIYANRAYEELLSWCQVSTARYSRVKVEDFTHSWKNGLALCAL
IHHFRPDLLDFTLLDQNDSIGNNQLALDVAEQELGIPPVLSSAEMASMSEPEQLGLITYL
SQFYDAFKNSPGRGSRFLTPRGTKGAILFLSKLQKSLSLSRKRNLVSLFAQQPVLSPLLD
NSTWDEQTKKKKQEPGSPPISPVRSSDACYICGEHVYIVERVSAEGRFFHRSCFKCHHCK
TTLRLGDFALNEDDGKLYKEEEEEEEQYESGSHDLGTEISTCCLVSRNWGDREPLLSTIT
TMFMHLSLPNRILAIIFNKSLLRPSFLISITTGNSVPFPGFFLSLRLKHSSFSVSLQGWS
LPSPFPHFCLAVDFSGESGRTQMGNAESVSSLSFLQLQDSLLPFIKNIFFNLTEEGQYPT
WKKTLIRRARDAQMKRFCKAQSIQRRLEEIEVTFRELEKQGVKLERYLREAAGTESELKR
AWMSQLLSLVQKKNSLMCEESDLMIAVQELKLEEQQCQLDQELRRYYNMDESSKTREDQQ
AEKKILSQLLEVVNQRSALIEMQENKRLSELS
Download sequence
Identical sequences 28377.ENSACAP00000009191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]