SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009332 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009332
Domain Number 1 Region: 238-432
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-47
Family DBL homology domain (DH-domain) 0.000000229
Further Details:      
 
Domain Number 2 Region: 424-548
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-36
Family Pleckstrin-homology domain (PH domain) 0.00000708
Further Details:      
 
Domain Number 3 Region: 1-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-25
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 163-232
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-23
Family SH3-domain 0.0000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009332
Sequence length 728
Comment (Anolis carolinensis)
Sequence
MNPEEQIVTWLISLGALNSPKMKVGDPLQFLKTSLKDGVVLCKLLLRLLPGSIEKHCPEP
KTEADCVGNIKAFLSGCAALKVELFDAHDLYAGDNFPQVLNTLAAICKATEDQPSARPCS
RLSPARSPSEDCPPSRKTTSPKSPRALRRQSKAVDMTENGGHQLVVRARFHFKQTNEDEL
SINKGDVICVTRVEEGGWWEGTLNGKTGWFPSNYVKEIKPTDKPLSPKALKNAESPQLTK
NYYAVVRGVLETERDYAKELHSLLSTYLRPLQSYDRLSAGDIALLLGNVDEICTFQQNLN
QALEEIAKLPEHLQKVGGCFMNLMPQFRLLYLAYCANHPSAVNVLTQHSDELEKFMELQG
ATCSGILTLTMSLSKPFTRLDKYTSLLQELERHMEEAHPDHEDVLKAVTSFKTLVSQCQE
MRKRKQLELQILSESIQGWEGDDIRSLGSVLYMSQVMVQYGGSEEKEERYFMLFSNVLLM
LSASPRMSGFLYQGKLPLMGMVVTKLEDADGTEHPFEISGGMIDRITVYCNNSHDLHEWL
DHLQRLTRGAASSGTLSKTHSWSPHSTFSSLGQSRGPLEPPKILKPWTLSCLRPAPPLRP
SVALSYKEAFGHMVNDSSKSPKTMKKFLPKRKTERKPSDEEFVIRKSTAALEEDAQILKV
IEAYCTGASFQQTLSSGSRKNSVAQVLLPEEEKIIIEETRSNGQTVTEEKSLVDTVYALK
DEVKELKQ
Download sequence
Identical sequences 28377.ENSACAP00000009332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]