SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009712
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-51
Family Calponin-homology domain, CH-domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 193-253
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.49e-21
Family EB1 dimerisation domain-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009712
Sequence length 267
Comment (Anolis carolinensis)
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAVYCQFMDMLFPGSVTLKK
VKFQAKLEHEYIQNYKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAPTPPMVVPILNKPKKNLAPSGTAPTRPMVAQRTTVANKTAPGMV
KKAPAGIGEDESAELIQQINVLKMTVEDLEKERDFYFGKLRNIELICQENEGESDPVLQR
IVEILYATDEGFVIPDEGAPPEEQEEY
Download sequence
Identical sequences ENSACAP00000009712 28377.ENSACAP00000009712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]