SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009774
Domain Number 1 Region: 839-1018
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-37
Family Laminin G-like module 0.0000053
Further Details:      
 
Domain Number 2 Region: 655-828
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-35
Family Laminin G-like module 0.0000254
Further Details:      
 
Domain Number 3 Region: 236-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-35
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 68-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-29
Family Laminin G-like module 0.00078
Further Details:      
 
Domain Number 5 Region: 429-612
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-26
Family Laminin G-like module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009774
Sequence length 1020
Comment (Anolis carolinensis)
Sequence
VAASAERKVNEVEIQAGLLFGRLKPLKVLEENLSRNISEIKELISQARKQAASIKVAVSA
ERDCIRAYQPQILSTNYNTLTLNVKTTEPDNLLFYLGSSGKIDFMAVEMRRGKVAFLWDM
GSGSTRLEYPDFAINNNKWYKIHATRFGKTGTLTVEETNSLQKPSVRSATSPGTATILDV
DQSTLMFIGGLGGQVKKSPAVKVTHFKGCMGEAALNGKTVGLWNYMEREGKCRGCFGSPQ
DEDIAFHFDGSGYSLVEKSLRSTVTQIILFFSTFSPNGLLVYLASNGTKDFLSLELVDGK
VKLMVDLGSGPLTLKTDSRYNNGTWYKISFSRNKKEGKMFMDAYNLSSKETKQGESPGTA
SDLNRSDRDPIYIGGLPRSRALRKGLSSRTYVGCIKNLEISRSTFDLLKNSYGVRKGCVL
EPIYSASILNSGYIELSPKPLSPESQLMATFVTKNTSGIILVGLSKGAEKRRRRQAHLPF
FSIVLVNGHLAVHVNAGDRASTRKVLVQPDNGTYSDGQEHSVILTRNKRMIMVQVDENSP
AEIRLGPLAEARPMNISHLFIGGIPAGEGILGLKMTNSFYGCITNLIFNMELLDFTTALR
YEGVDMGSCFLWDKPKPAIHPEDPEILSEMQMLPVSLQPLAQFKEKPCAEDETLNYVSGA
YQFGLSGNSHLVLLFNHSTVRKKLSVQLNLRTFASSGLLYYMAHQKQLDYAALQLHGGKL
YFSFDLGKGRAVAFHDTIVNDGKWHTVRTEYMKKKGLIIVDGHESVAVNVPGDGNTLDVD
GKLYLGGLPFDYSARNIGNITHSIPACIGGITVNNKQVDKDSPLSIFSVNKCYTAAQEGT
FFDGSGFLALVKEGYKVRSDVNITFEFRTTIANGVLLGISSAKVDAIGLELVTGKVLFSV
NNGAGRITATYEPKGTASLCDGRWHKLQANKSKHHIALTVDGNLVQTENPHTHSTSADTN
NPIYVGGYPADVKQNCLTSKSSFQGCLRNLILIKGQQLESFDFSEAFDLRGVFPHSCPGA
Download sequence
Identical sequences 28377.ENSACAP00000009774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]