SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000009832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000009832
Domain Number 1 Region: 185-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-45
Family Galectin (animal S-lectin) 0.00021
Further Details:      
 
Domain Number 2 Region: 11-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-44
Family Galectin (animal S-lectin) 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000009832
Sequence length 318
Comment (Anolis carolinensis)
Sequence
MSYVPAPGYMPAFNPVLPYNQPIPGGLRPGMSIYVQGKVPHHTKRFRVNFACAPHEGADI
ALHFNPRFDGKDKVVLNTFHGGKWGKEEHQSMPLHKDQHFEIVFIVNNSGYQILVNRNPF
CNYNHRIPPERVQVVSADGDLDLQSVTVLGGGMMGVSMAQIWKRAARTGWDLLSFLPFRG
HHSQLGPQVPYVGNLPGGLGAKKTIVVRGFIPQDAKRFCINFKAGQEIALHINPRLDERV
VVRNSFLGGRWGPEERELSVNPFQRGQYFDLSIRCGNQQFKIFIDGQPLFNYKHRFHNFQ
HINTLEIDGDVMLSYVQS
Download sequence
Identical sequences 28377.ENSACAP00000009832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]