SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000010055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000010055
Domain Number 1 Region: 73-153
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 356-405
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000215
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 1-50
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000010055
Sequence length 410
Comment (Anolis carolinensis)
Sequence
GCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNG
PALGGLPCNPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVF
EVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGNLGSAWLTSNPV
PPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGETLPPSVGA
EDLAVDSPAYDSLPTPSQTIWTPFEPVNPLSTFGSEPASNAKTPRRGSQPSTPRLSPTFP
ETLEHPLARRVRSDPPSTVGQVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPELRRKHDCV
ICFENEVIAALVPCGHNLFCMECANKICEKEAPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences ENSACAP00000010055 28377.ENSACAP00000010055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]