SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000010383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000010383
Domain Number 1 Region: 1175-1393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-37
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 222-334
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-31
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 638-750
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-28
Family Cadherin 0.00064
Further Details:      
 
Domain Number 4 Region: 327-432
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-28
Family Cadherin 0.00072
Further Details:      
 
Domain Number 5 Region: 1425-1622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-27
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 114-220
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.00077
Further Details:      
 
Domain Number 7 Region: 9-112
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 744-844
Classification Level Classification E-value
Superfamily Cadherin-like 4e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 529-636
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 432-533
Classification Level Classification E-value
Superfamily Cadherin-like 5e-23
Family Cadherin 0.00095
Further Details:      
 
Domain Number 11 Region: 1115-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 846-947
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000005
Family Cadherin 0.0077
Further Details:      
 
Domain Number 13 Region: 1755-1795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1661-1706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000073
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1626-1660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000743
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000010383
Domain Number - Region: 1094-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00271
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1405-1433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000010383
Sequence length 2753
Comment (Anolis carolinensis)
Sequence
RKKRNANASPQFQAPTYQVSVPENRPAGTPVIVLKAVDPDEGEWGRLDYSMDALFDSRSN
SFFAIDPRSGAVTTAEELDRETKSSHVFRVTATDHGVPRRTAMATLSVTVADTNDHDPVF
EQQEYKESMRENLEVGYEVLTVRATDGDASPNANILYHLLNGRGVNKIFEIDPKSGVIRT
NGLVDREAVESYQLIVEANDQGRDPGPRSTTATIHITVEDDNDNSPQFSEKRYVVQVPEN
VASNTHVLRVNATDRDKGSNALVHYSIMSGNTRGQFYIDAQTGNIDVVSQLDYEMNKEYS
LRIRAQDGGRPPLSNISGLVAIQVLDVNDNSPIFVSTPFQSTVLENVPVGYSVIHIQAID
ADSGENARLEYALVDISSDFPFSINNNTGWILVASELDRENVDFYNFGVEARDHGNPPMT
SSASVSITILDVNDNNPEFTQKEYSMRLNEDAAVGTSVLTVSAIDRDVNSVITYQITNGN
TRNRFSITSQSGGGLITLALPLDYKLERHYLLTITASDGTRLDTAQVFVNVTDANTHRPV
FQSSHYTVNINEDRPVGTTVVIISATDEDTGENARITYFMEDSIPQFKIDMDTGAVTTQM
DLDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDNYQGSVYEDVPAF
TSVLQVSATDRDSGLNGRVFYTFQGGDDGDGDFIIESTSGIVRTLRRLDRENVPLYELRA
YAVDKGVPAMRTPIEVHITVLDVNDNPPVFEQDEFDIFVEENSPIGLVVARITASDPDEG
TNAQIMYQIVEGNIPEVFQLDIFSGELTALMDLDYETKSEYVIVVQATSAPLVSRATVHV
RLRDKNDNIPILKNFEIIFNNYITNRSSSFPTGVIGRIPASDPDVSDTLSYSFEQGNELK
LVLLNHSTGELRLSRALDNRPLEAVMRVSVSDGIHSVAAQCMLQVTIITDEMLTNSITLR
LENMSQERFLSPLLALFLEGVAMVLSVPREHVVLFNIQNDSDVQAAHILNVSLSVLLPDG
AYGGHYIPSEDLQERLYLNRTLLAAISEQRVLPFDDNICLREPCENYMRCVSVLKFDSSA
PFIASKTILFRPIHPVNGLRCRCPLGFTGDYCETEIDLCYSNPCGNNGYCRSREGGYTCE
CQEGYTGENCEVNSRLGRCTPGVCRNGGTCVNLLVGGFKCDCLSGDYEKPYCQMSTRSFP
AHSFLTFKGLRQRFHFTIALTFATKERDGLLLYNGRFNERHDFVALEIVQEQVQLTFSAG
ESTSTVAPFIPGGVSDGQWHTVHLHYYNKPLMGMSGIPQGPSEQKVAVVTVDDCDTSVAL
KFGSLLGNYSCSAQGMQSGTKKSLDLTGPLLLGGVPDLPESFPVRNRHFVGCIRDFLIDN
REVDMADFIANNGTVPGMYTQNIICDSNTCHNGGTCVNQWNTFSCECPLGFGGKDCKQEM
ASPQRFLGNSMVTWSNLALVITLPWHVGLMFRTRQSNGILLHAAAGQHSSITLGLSEGHV
LMTVYRANSQVSALRLYQVKVNDGDWHHLKLELHSNKDYLDAQCLALMAFDYGLHQVMAN
ISSELHGLKVRNLSIGAVLGEQGQVQQGFRGCMQGVRMGETSASAVALNVNQAEKVNVEH
GCSIPDPCDSNPCPVNSYCNDDWDSYSCSCDPGYYGDNCANVCSLNPCEHQAVCARKPSS
SHGYTCECPENYFGPYCENKLAQPCPRGWWGHPICGPCNCDVSKGFDPDCNKTNGECHCK
DNHYQPLGSAMCLLCDCYPTGSLSRTCESETGLCSCKPGVIGRRCDRCDNPFAEVTVNGC
EVNYDSCPRAIEANIWWPRTRFGLPAAASCPRGSVGTAVRHCDEHKGWMAPNLFNCTSLT
FAPLKGFAEKLLRNESILDTEQSQRVALQLRNATQNTARFFGSDIKVAYLLSAQLLKHES
TQEGFGLAATQDVHFTENLLKVGSALLDNSNKRHWELIQQSEGGTAQLLKHFEDYASTLA
QNMRKTYLNPFTIITPNIVISVVRLEKMNFAGAKLPHYEALRGEKPADLETTVILPESVF
KASEGKYSSHLPGSSDEDEPALMTRQKRHPDLSEGQAIASVIIYRTLAGLLPEQYDTDKR
SLRVPKRPIINTPVVSINIHDNDALMQRALEKPITVQFRLLETEERTKPICVFWNHSILL
SGTGGWSAKGCEVVFRNETHVSCQCNHMTSFAVLMDISRRENGEILPLKTITYASIAVTL
GSLLLTFLFLAGLRVLRSNQQSIRKNLVVSLFLSELVFLLGINQADLPFACTVIAILLHF
LYMCTFAWALLEALHIYRMLSEVRDINYGPMRFYYMVGWGVPAFITGLAVGLDPEGYGNP
DFCWLSIYDTLIWSFAGPIAFAVAMSVFLYVLATKATCAAQQQGFEKKGTVSGLRSGFVS
LLLISVTWLLALLSVNSDAILFHYLFAGFNCLQGPLIFLLCVILCKEVRKALKSSCGKKH
GTDPTLTTKSTLTAAYNCNNTYVDGQLYHTPFGDSTGSLHSTVRSGKSQHSYIPFVLREE
SGLNNSQVHLGPADPSSLFLEAKDQNNERDTDSDSDLSLEDDQSGSYASTHSSDSEEDEE
FPREPCWENLLCPNNDKLVAHSTPKVDNLPGPGKPYWPGDFVTTASEKATCGATEEIPRE
NGETQTREGIMGSLPHSTAQPYKGILKKKCLPPISEKNSIQRIHNKLASCRSGMVSSHGS
SGSDGSRGGGAPRPRQTLQEQLNGLTPITMSIKTGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences 28377.ENSACAP00000010383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]