SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011111
Domain Number 1 Region: 966-1295
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-84
Family Ankyrin repeat 0.00000659
Further Details:      
 
Domain Number 2 Region: 122-445
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.67e-78
Family Ankyrin repeat 0.0000298
Further Details:      
 
Domain Number 3 Region: 383-603
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.06e-56
Family Ankyrin repeat 0.000077
Further Details:      
 
Domain Number 4 Region: 1613-1681
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011111
Sequence length 2487
Comment (Anolis carolinensis)
Sequence
EEEDEEEEDDEEVSEVESFILDQDDLENPMLETASKLLLSSTADGADLRTVDPETQARLE
ALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTASAGQMDNR
SLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDR
GVKGDITPLMAAANGGHVKIVKLLLAHGADVNAQSSTGNTALTYACAGGYVDVVKALLES
GASIEDHNENGHTPLMEAGSAGHVEVARVLLENGAGINTHSNEFKESALTLACYKGHLEM
VRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAAC
GGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQET
ALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTAT
GDTALTYACENGHTDVADVLLQADADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANV
NRTTANNDHTVLSLACAGGHLAVVELLLAHGSDPTHRLKDGSTMLIEAAKGGHTSVVCYL
LDYPNNLLSAPPPESTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVATTLPIRN
KATSKQKSSSHLQPASPDVQGYIANQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLE
LAHADQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRI
QLQQQQQQQQSCQHLGLLTPVGVGEQLSEGDYARLQQVDPYLLKDDPQQAAAQMGFAPIQ
PLAMPQALPLATSSLPPGSIANLTELQGVIVGQPVLGQAQLTGLGQGILTDAQQGLMVAS
PAQTLNDTLDDIMAAVSGRASAVSNPPTHNIVTSVSQPQTPAPSPIISPSAMLPVYPAID
IDAQTESNHDTALTLACAGGHEELVQTLLERGANIEHRDKKGFTPLILAATAGHVGVVEI
LLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGG
YVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNT
ALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAP
PVPSSRDTALTIAADKGHYKFCELLISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQ
AGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATVTDKEMLKKC
HLCIESIVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEE
QRRKLEEIEAKNKENFELQAAQEKEKLKAEDEPEVLTEPPSATTITTIGISATWTTLAGS
HGKRINTVTTSSSKRKSRKNKINQDSVQIIFDEQLPISYSQPEKMNGESKSSSTSESGDS
DNMRISSCSDESSNSNSSLKSDSQSSTMAPIAQSNKKQPSVLVTFPKEERKAVSGKSSVK
LSDVITEVTNNSLSTCTKSCPSPLSSPNGKITLASPKRGQKREGGREVVRRQSKKVSVPS
TVISRVIGRGGCNINAIREFTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIK
DPDKEIDELIPKNRLKNSAAYPKTGMAIHTATATAHSSVNGSKATTVAISSSPQISTALS
VPAACSVSTHKTVKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHF
GGTFPPAQSTWGPFPVRPLSPARATNSPKPHTVPRHNNQNSSGSQVNSVGSSTSSPTATT
SSAVSTVPVSSASGSPSSPSVRRQLFVTVVKTSSTTTTTIATTASNNSTTPTNATYPFPT
AKEHYPVSSTSSPSPPAQPVRASRSSPSECVTGSPSKGVLSSDQEVGSPPAVEAANLASN
RQSSSGSVGVSSEHPSQPQPLRSVSQEARPPLQQPQVPSQDPRMVVPPNLAAVIAPAIAP
VNSPANYLLPQASSGRAQLVYLLAFEFQGIPSLSFTFRSQQSAVVALGLHLLAQNGCLVP
DTSVGLEMCCGPTLKHRCFHPPNKSMATNFSAALPFGPFSTLFENNPASAHAFWGGSVLS
SQTAPESIIPGKSSFLPNPDTLHQLDTSKAPGFRPPLQRPAPNSSGIVSMDSPYGSVTPS
THLGNFASNISSGQVYAPGTPLGGAPAAANFNRQHFSPLNLLPPCSSASNEPPAQPVSAG
VRAPSPTPSAVSLGSEKPNSVSQDRKVPVPIGTERSARIRQTGTTTPSVIGSNLATPVGH
SGIWSFEGIGGNQDKVDWCHSGMGNHMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQ
HVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIADGAGGPVFNGPHAADPSWNSLIKMVSNS
TENNGPQTVWTGTWTPHMNSVHMNQLG
Download sequence
Identical sequences 28377.ENSACAP00000011111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]