SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011377
Domain Number 1 Region: 268-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-51
Family SPRY domain 0.0000464
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Immunoglobulin 1.78e-20
Family V set domains (antibody variable domain-like) 0.00029
Further Details:      
 
Domain Number 3 Region: 123-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000344
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011377
Sequence length 426
Comment (Anolis carolinensis)
Sequence
GPLHPVTASLSEDIVLHCHLSPRTSAENMEIKWFRSQNSSYVHLYHNGKEHLEKQQPEYQ
GRTELLTDGIEDGKIGLRILNVSFYDAGQYHCSVKNKSFHQEATLDIKVAALGSTPLISI
ERYQERGIYLVCRSRGWYPQPEVLWRNPSGKHLSFLAKETSQENNGLFEVQKDILLTEGS
NQPLTCVVRNRLLNQEKGSTIHVADNFFPKIDPWAVGLCVSILVPVGLLIAILYLINRNT
QIEQRLFRSLPPLFFFSLILPFSLPSPFHHAANVTLDPSTANKELILSADQKNVIQGFMW
HNLPDHPWRFDVERCILGKEGFSSGRHYWEVEVGEEGYWAVGVARESVRRKGRLSLDPDE
GIWAVEKARVQTVQYQALTIPQTPLTLRKRPRKVGIYLDYELGKVAFHDVNHKMHIFTFF
AADFNG
Download sequence
Identical sequences 28377.ENSACAP00000011377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]