SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011403
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily POZ domain 1.94e-32
Family Tetramerization domain of potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011403
Sequence length 237
Comment (Anolis carolinensis)
Sequence
MDNGDWGYIMTEPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFRGDFPTARDSQGNYFIDR
DGPLFRYVLNFLRTSELTLPVDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPVDTFEEV
VELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFG
PCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
Download sequence
Identical sequences G1KLC1
ENSACAP00000011403 ENSACAP00000011403 XP_003217886.1.98722 XP_008103635.1.98722 28377.ENSACAP00000011403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]