SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011648
Domain Number 1 Region: 98-189
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.44e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 241-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00012
Further Details:      
 
Domain Number 3 Region: 15-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011648
Sequence length 404
Comment (Anolis carolinensis)
Sequence
MSSSDNGLEETELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSTARITISEGSCPER
ITTITGSTDAVFRAVSMIAFKLEEDLGTGAINGGTVSKPPVTLRLVIPASQCGSLIGKAG
AKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIQCVRQICAVILESPPKGATIP
YHPNLSLGPVLLSANQGFSMQGQYGGISQAEASVAKLQQLSGHPVSFSSLGQTPSIVAGL
DTNSQNSSQEFLVPNDLIGCIIGRQGSKISEIRQMSGAHIKIGNQTEGSAERHVTITGTP
VSITLAQYLISACLETAKSTSQTPPPLTPSPAPTLTAVAAPPPALLGAPYAISLSNFIGL
KPVPFLTLPPSSAAGHNGSLATYTTKISTANASKKAERQKFSPY
Download sequence
Identical sequences 28377.ENSACAP00000011648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]