SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000012094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000012094
Domain Number 1 Region: 307-403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-34
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 10-77
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-24
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 87-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000321
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000012094
Sequence length 404
Comment (Anolis carolinensis)
Sequence
AMASGDPAKKLCEELACPICLEYFEEPVIISCGHNFCQSCLDQWWEEEASCPQCREEVQE
RDIKRNWQLANLVEIAKELGRQKAEEKGRVCQRHQEPLKLFCKNHKAPICVVCDKGKEHK
YHKVIPLDEASKEYKDCIWNFLETLKKEREKILAFKADATRESQDLLVFFKCRRTKFWQP
PPPNQSLKNKSRNLLAKMEEVEKEISAKGGEHLARLSEELSSLSKLIQEMEEKHQQPASE
LLQASSHNIQSIEREKFETPVAFPPALKWKIWDFCDINPFLEGVMKQFRVLKQNEIHVRW
KLNPPAIYISHVTLDPDTAHPRLILSENRRRVTLRQKRQNLPDNPERFNQHFFVLGQEGF
RGGRHFWEVLVENGERWSVGVARKSVQRKGSFPVGPDAGIWRVA
Download sequence
Identical sequences 28377.ENSACAP00000012094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]