SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000012927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000012927
Domain Number 1 Region: 1379-1577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.17e-37
Family Pentraxin (pentaxin) 0.00073
Further Details:      
 
Domain Number 2 Region: 23-212
Classification Level Classification E-value
Superfamily vWA-like 2.75e-37
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 3 Region: 1798-1867
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.26e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 2097-2166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-19
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 5 Region: 2843-2912
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.92e-19
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 2669-2738
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.04e-19
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 2727-2796
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 2332-2401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 3193-3262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 2785-2854
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 11 Region: 1740-1809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.21e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1914-1982
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.16e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 3252-3318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.17e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 2155-2226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 3370-3429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 3016-3084
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2216-2284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 18 Region: 1635-1698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 19 Region: 2506-2573
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000275
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 20 Region: 1248-1373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 21 Region: 2390-2459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 22 Region: 2902-2964
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000472
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 2448-2511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000126
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 2626-2680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000688
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 25 Region: 1856-1919
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000723
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 1589-1652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 27 Region: 390-457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 28 Region: 3311-3378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 2961-3021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 30 Region: 3075-3138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 31 Region: 329-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 32 Region: 2275-2343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 33 Region: 1971-2039
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000695
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 939-1082
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000181
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 35 Region: 1184-1226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000041
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 36 Region: 3135-3199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000514
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 37 Region: 1222-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000536
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 38 Region: 2036-2103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000082
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 39 Region: 1147-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.012
Further Details:      
 
Domain Number 40 Region: 449-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000133
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 41 Region: 1694-1737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000012927
Domain Number - Region: 230-386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000145
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 3421-3458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000244
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 680-733
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000306
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number - Region: 3461-3489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00202
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 3490-3518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00664
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000012927
Sequence length 3519
Comment (Anolis carolinensis)
Sequence
GSRVERLGRAFKRQVRRLREGSARLELVFLVDESSSVGQANFRSELRFVTKLLSDFPVVP
TATRVAIVTFSSKNHVLSRVDYISPPSPGRTQPQQQRQQQQKCALLGREIPGIGYRGGGT
YTKGAFQQAAQILLHSRANATKVIFLITDGYSNGGDPRPIAASLREFGVEIFTFGIWQGN
IRELNDMASHPKEEHCYLLHSFTEFEALARRALHEDLPSGSYIQEDISHCSYLCDGSENC
CDIMASCKCGTHTGQFECICEKGYYGKGLQHECSACPPGTYKPEGSPGGISTCIACPDEN
HTSPPGSTSVEDCMCKEGYHAKGQTCEVVHCPQLQPPENGYFIQNVCNNYFNAACGIRCK
TGFDLVGSGIRLCQPNGLWSGSETTCRVRTCPKLVAPQNGWINCSRTVISYKTVCFVTCN
DGYELEGNVKLTCQNNAQWDGKEPKCVELHCPAFQKPKHVTVHPHLCGFEPSKSGTVCRF
TCPNGFLLSGVREELRCLTTGRWSENMQKAFCKDIEPPNISCPDDIEASTLEYQNSANIS
WEVPEANDNSRDEVSIQVTPAFVPPYFFPIGEVAITYTATDRSGNQASCTFSIKVIDTEP
PVIDKCRSPPPVQVAEKECKVTWDEPQFSDNSGADLAITKSHSPGDIFPKGETVVWYTAM
DPSGNNRTCELHVIIRGSPCEIPFTPVNGDFKCTEDETGVNCTLHCMDGYDLTAGSSENY
YCAYADGIWNPPYSTEWPDCSLNRLANHGFKSFEMLYKATRCDDNNLLKNFVDAFQSALG
KMVPSFCNDVDDIDCRLEDFPKKHCLEYNYDYENGFAIGPGGWGTANRLDYSYDDFLEAT
PEEEQAKPIAVKRHKKINIPMTDYKIKLVFNITASVPLPDERNDTLESENQQRLLKTLET
ITKRLKRTLSKDPMYSFQFSSELLVADTNSLEAEKAFLFCRPGSVLRGRMCVNCPLGTYY
SLEHHACESCWIGSYQDEEGQLECKNCPSASYTEYLHSRSVSECKAQCKPGTYSPNGLEI
CESCPFGKYQPATGSKQCISCPENMATVKRGAVDVSACGVPCPAGEFSRSGLMPCHPCPR
DYYQPDPGKSYCLSCPFYGTTTVIGARSITDCSSFGSTFSAAEESVAQPVAHSGHIQTAL
KICSTTFHECFLQPCHNSGTCKQVGSGYICICPPGYGGLKCEKDIDECSSSPCLNKGICK
DGTAAFTCQCQPGYSGLLCEEDINECSSNPCLNKAVCVDDINSYQCLCTEGFMGTNCETQ
INECLSNPCLNKATCEDQIGSFLCRCPPGFIGVLCEKNINECLSRPCKNGATCKDGINGY
RCHCVTGYRGSQCEVNINECESNPCMNQATCVDALNSYICKCPPGFTGSRCETEQSSRFN
LDFEVSGIYGYVMLDSVLPSLTEITCAFWMKSSDTTNYGTPVSYAVENGSDNAFLLTDYN
GWVLYVNGKESITDCPSVNDGKWHHIAVTWTSLDGAWRVYIDGKISDGGSGLSVGSEIPG
GGALVLGQEQDRRGEGFNPAESFVGSISQLNIWGYVLSPDQVKLLATSCPEELQKGNVLA
WPDFLPGVVGRVKIDSKSIFCADCQPLQGSIPHLRTSSTDLKPGSKITLSCDPGFHIMGN
SVLHCLNLGQWAQPLPRCERISCGVPPPLENGFHSAEDYFAGSTVTYQCNSGYYLLGDSK
MLCADNGSWNFISPACLDVDECAVGSDCDPHASCLNTNGSYICTCIYPYKGDGKKCTEPV
KCKHPGHPEHGHSHGASSSVGSEISFSCDMGYQLKGVTTVTCLESGEWSQLIPYCEAISC
GMPAVPENGVIEGSNFTYGNKVIYRCDKGYILKGEEKAVCLPNGKWNHSSPVCELVKCPH
PMKINNGKYVMSDTTYLSNVSYTCDTGYSLQGASMLVCEDTANWSSLPPECKIVSCDLPP
VIKDAIVTGNNFTFGNSITYMCKEGYTLIGPETVECMANGQWDFNHQQCVAVSCDEPPPV
EHASPESGHRLFGDEAIYYCSDGYSLAGNAQLLCNAQGNWVPPAGKDVPECIADFCERPL
SVSYSILESSNKAKFAAGSVVSFKCMEGFVLNTSAKIECVRGGQWTPSPLTIQCIPVRCG
DPPSIRNGYAIGSNYSFGAIVAYSCTRGYYIKGEKKRTCEATGTWSGTVPTCHPVSCGEP
IKLPNGLIENITGHSFGSEVRYQCNPGYQLIGSPLLFCQANRQWHSEVPPSCVLLTCGEP
PPLEHGFRKGKSFEVGVKVTFVCDEGYELIGDASWVCQKTGTWNKKQNPKCVPTKCPEPP
LIENQLVLKEMADQVGVVQFSCKEGFILHGASILKCLSSQQWNDSFPSCQMVLCHRPPYI
PFGDSVVSTLHFGSTVTYTCMDGFLLKGVSTINCQEDGTWSFPLPECIPVECPQPEEIQN
GIVDVQGLTYLSTALYNCKPGFELMGNMTVLCGEDGHWLGGKPTCKPIECSKPKEIQNGR
YSYIDLHYRQTVTYSCDRGFQLEGQSVLSCLESREWDSEVPSCRAITCDPPQPIENGFVE
GADYSYGAMVIYSCIPGFQLSGLAMQTCEELGWSSVSPVCLPTDCGLPPHIDFGGYITIS
SEEKPYGQEGILQEGFHTARPPIFSLILENQKDMQSSPRAINTLPLSGYLYGTTIIYSCF
LGYELLGNYVLSCQEDGMWNGSAPVCISIQCELLLPPQNGFVHFTENTLGSTVKYTCKPG
YKLIGSETRVCTSSRQWSDAAPTCEIVSCTVPSKPMNGIVKGEAYTYGSVIQYGCNPGFQ
LNGSEKRTCLADQKWDGNEPICIPISCGQAPNLENGQVTGDEYTFQKYVEYSCGEGFLLE
GDQKRVCLADGSWSGHPPVCRAIQCPAPLKLLHGEISGSEFGFGKSIVYRCDEGYVIQGA
SSLTCQANGFWDKEVPFCEPVNCGPPEDIAHGFLNGSVFSYGKYIEYVCFPGYELHGSPV
RRCMSNGLWSGKPSSCLPCECPVPTIQNGVIKGNSFGCGKKVGFECLEGYKLLGPSEITC
EAAGRWSSGFPYCGLISCGPPPTIPNAFINGSNSVDQNGILYNCEMGFVMQGSSELTCTE
NGVWSKPYPSCILLTCGPPPSVPHAVALGDSQAYGSKVQYRCLEGYVMETEMDTCTCQED
GHWSLDMISCCPQKCPLPENINNIIISGAEFTVNKSITLSCPEGYLLIGARNSTCQNDGN
WMPLFSSDICAPVSCGLPEFPDHGIVVGNKYNYKDTILYKCSSGYELDGDAERTCQADKL
WSGATPMCKKTRCEDPEFIENGNALYENNTVGSRAAYYCNRGYTLEGEPIAECTEAGTWS
HPIPLCKPNPCPVPFIIPENALLSETTFYVGQKVFIKCREGYQLRGPSVITCNPDEAWTP
TRAKCEKISCGPPAHVENALIRGTFFQYGDMVTFSCYSGFMLEGSLRSVCLENGTWSTPP
ACKAICRFPCQNGGVCERPNVCSCPDGWMGRLCEEPICILHCLNGGRCVAPYQCDCPIGW
TGSRCHQAVCQSPCLNGGKCVRPNRCHCTSPWTGHDCSR
Download sequence
Identical sequences 28377.ENSACAP00000012927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]