SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000013072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000013072
Domain Number 1 Region: 17-205
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.06e-50
Family Astacin 0.00021
Further Details:      
 
Domain Number 2 Region: 377-548
Classification Level Classification E-value
Superfamily TRAF domain-like 3.43e-34
Family MATH domain 0.00098
Further Details:      
 
Domain Number 3 Region: 214-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-27
Family MAM domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000013072
Sequence length 552
Comment (Anolis carolinensis)
Sequence
FEGDIIVPLEKNALRNSSYRWKLPVPYIMGDSLDLNTRGVILQAFEMFRLKSCIDFKPYE
GEKSYLQFEKLDGCWSFVGDFQTGQNVSIGPRCEYKDTVEHEVLHALGFYHEQSRTDRDD
YVNIWWGEIIEGQEHNFNKYDDDFISDLNTPYDYESVMHYGPYSFNRNSSIPSITTKISE
FNDVIGQSQDLSRIDLQRLNRMYNCASSLTLLDQCSFESINICGMIQNAKDDADWQHTQD
SQPMEQNHTQRQECKDAGHFMYFNTSCGKQGDTAVLESRILHPTRNYHCLQYFFKMTGSP
QDRLAVWIKKDDGTGKIRRLIKVRTFQGDNDHNWKIAHVNFRCQKKFRFLFYGLKGNPDD
SNGGIFIDDLTLSEAQCPRAVWLIRGFSRLLTTASSDLSITSPRFYSQEGYGFGITVAPR
GSRDSAFANYTRISFHLVSGENDGILEWPALHRQVTITVLDQNPNAKKRMSAERSFTTDT
TQVFPDKNNSSRWGKPSLLGKFDTSCNCSRNGGWGWSKFISHALLRRKNFLKNGDLIIFA
EFEDLTHLRKTE
Download sequence
Identical sequences 28377.ENSACAP00000013072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]