SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000013134 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000013134
Domain Number 1 Region: 897-1024,1220-1409
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.88e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 582-686
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000019
Family Other IPT/TIG domains 0.094
Further Details:      
 
Domain Number 3 Region: 399-494
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000374
Family Other IPT/TIG domains 0.0083
Further Details:      
 
Domain Number 4 Region: 499-581
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000395
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 54-106
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000589
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 10-57
Classification Level Classification E-value
Superfamily Sema domain 0.0000000157
Family Sema domain 0.019
Further Details:      
 
Domain Number 7 Region: 683-764
Classification Level Classification E-value
Superfamily E set domains 0.00000113
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Domain Number 8 Region: 353-384
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000628
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000013134
Domain Number - Region: 199-238
Classification Level Classification E-value
Superfamily Plexin repeat 0.0628
Family Plexin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000013134
Sequence length 1439
Comment (Anolis carolinensis)
Sequence
QIRVDGVVKGALEYEIVQVVDSGPILRDMAFSMDHKYLYIMSEKQLTRVPVESCGQYKSC
SECLGSGDPHCGWCVLHNTCTRKEQCERSSEPRRFASEMKQCVRLTVHPNNISVSQYSVM
LVLETYNVPELSDGVNCTFGDLSEMDGVVMGNQIKCQSPAAKEVPKIITENGDHHIVQLQ
LKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPRNCHFLEGRVK
LPEDCPQLLHANKILVPVEVVKPITLKAKNLPQPQSGQRGYECIINIQGNEKRVPALRFN
SSSVQCQNTSYSYEGMEINSLPVELTVVWNGNFNIDNPAQNKVHLYKCGAMRDSCGLCLK
ADPDYECGWCEDMNQCTLKQHCLLIENRWLELSATGGKCTNPRITEITPNRGPREGGTRV
TIRGENLGLEFRDIAFRVRVAGVECEPLVDGYIPAEQIVCEMTEAKLSQHAGYVEICVAT
CKPEFMARSSQFYYFTVLTLYDLSPDQGPLSGGTQVTIRGKNLNAGSNVSVMFGQHPCIF
HWRNADSIICNTTAFTNSLERSVVDVTVKKPKSHKELKFKYVEDPTVLRIEPEWSIVSGN
TPITVWGTNLDLIQNPQIRSKYGGKEHINVCEVQNDTEMVCQAPALAIDPNNLSDLTERP
EEFGFILDNVQSLLILNKTNFTYYPNPVFEAFNPSGILELKPGTPIILKGKNLIPPVAGG
NIKLNYTVLVGEKPCAVTVSDVQLLCEAPNLTGRHKVMARVGGMEFSPGTVNISPDSPLS
LPAIVGIAVAGGLLIIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAE
LQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQDRVEKGLKLF
AQLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDK
NLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPID
AITGEARYSLSEDKLIRQQIDYKTLVLSCVNPDNVNSPEIPVKILNCDTITQVKEKILDA
IFKNVPCSHRPKAADMDLEWRQASGARMILQDEDLTTKIENDWKRLNTLAHYQVPDGSVV
ALVSKQVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLV
KNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKY
MFDFLDEQADKHNIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVA
QTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAE
QSRMHMNEFNTMSSLSEIYSYVGKYNEEILGALDQDDQAGKQKLAYKLEQVITLMSIDS
Download sequence
Identical sequences 28377.ENSACAP00000013134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]