SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000013954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000013954
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.73e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 120-306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-33
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 323-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-31
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 4 Region: 756-930
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-28
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 5 Region: 938-965,1015-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-27
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 6 Region: 549-611
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000374
Family Fibrinogen C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 7 Region: 519-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000013954
Sequence length 1287
Comment (Anolis carolinensis)
Sequence
CEYELVGPLYTWNLASSSRSSIFRAATFGRIYGAGGWSPDPKDKHPWLQIDLTKKAHIKS
IATQGTFNSYNWVTRYIVLYGDHPNNWKPYFQRGSNWTFFGNMNASGVVRHELHYPILAR
YLRIIPVAWNPHGHIGLRVGLYGCYYQSDILYFDGDDAISYRFRIRTMRTMQDRLAFNFK
TMEREGLLMYGAGAQGDYIRVELHQAQLVLSMSLGNSSLNMSGGETIMKMGNLLDDQHWH
QFRLDRYRQFVNFSLDGEVVHFRLNGAFEQLDLDREIFFGGVMNYEKHRLAYHQNFRGCM
ENIVYNLVYISTMARLRKPAIRVDGHIGFFCRDNFLFPFTFAGVNNFLQVPGYPRRNQLM
VSFSFRTWDVVGLLLYTPFADDLGWLEMVLSDGQVNVTIAQPKTKTKKVEFGAGYRLNDG
FWHSVSLVVRETSAVITIDDQNDASFRVDRDIQLRTGNQYFFGGCPKPASRTGCNSNQTA
FHGCMQMVTVDRQPIELDMVRLHRLGKYFEVYFNVCGVIDRCTPNMCEHGSRCIQSWDDF
KCICDLTGYKGETCHTAVYKETCDAYRLSGKTSGNYTIDPDGSGPLKPFNVYCDIREDRA
WTTVWHNRYWLTRVTGYSPENPFLGTVDYWNASWAEVSALANASEYCEQQIEFRCYFSRL
LNTQTGMPLSFWMGRNAERHYYWGGSPPGLGRCACGMDKNCADPRFYCNCDADHFMWRAD
KGLLNFVDHLPVTQVVVMDTNRTGSEAQFYVGPLRCYGDRNSWNTVSFVRGNALIFPTFQ
MNYSLDISFFFKTSAPTGTFLENVGPINYIRVELNTSQDMVFAYNIGNGDENLTLHSEVP
FNDNEWHEVKAEINVKLIRLRVDRRPWVIRIVPPQSFIYMNLTKPLYVGTAQYYLNPFLG
CLRGLHMNGVTLNLEGKANETEGVLVNCTGHCRNPLVPCRNHGTCVEHYSHYTCNCSVSA
YEGPFCNRGVWGSFFVWDGRMFFDVLSSLWKASLMSPHGAGADRGSSSALSPGEIRTWQP
SGHNPTFNLPTYQPLQPLPGYNLTGEEVGLSFRTSSAPAVLLYVSTFVRDYMAILIRDDG
ILQLRYQLGTLPYIVALSTRSVADGHPHRINITRVNRTLYTQLDYYPIVVHQFSLLVDSK
LDSPKALYLGRFMETGTIDPDIQRYNTPGFTGCLSGVKFNSIVPLKSIFRPSGSNPMAPY
STKGRLVESNCASMPSSYIEVPPELDPWYIEPVEFIYIHDDGWVAIVIGVFLFLLLLLAA
ALILMYLHHHRYKGSYHTNEPKAIQDY
Download sequence
Identical sequences 28377.ENSACAP00000013954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]